2CUB: SH3 domain of the human cytoplasmic protein Nck1

Solution structure of the SH3 domain of the human cytoplasmic protein Nck1. Determined by solution NMR. Released 26 Nov 2005.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 670
Mol. weight: 9.55 kDa
Released: 26 Nov 2005

Explore 2CUB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2CUB contains 2 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	13	1	1
β-strand	18-22	5	1
β-strand	33	1	1
β-strand	40-47	8	1
β-strand	52-57	6	1
β-strand	60-65	6	1
α-helix	66-68	3
β-strand	69-71	3	1
α-helix	80-81	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cytoplasmic protein NCK1	A	protein	88	Homo sapiens	P16333 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2CUB_1 Cytoplasmic protein NCK1 (chains A)
GSSGSSGDPGERLYDLNMPAYVKFNYMAEREDELSLIKGTKVIVMEKCSDGWWRGSYNGQ
VGWFPSNYVTEEGDSPLGDHVGSGPSSG

Primary citation

Solution structure of the SH3 domain of the human cytoplasmic protein Nck1. Ohnishi, S., Kigawa, T., Sato, M. et al. To be published.

Other PDB entries of the same protein (UniProt P16333 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5QU8 0.93 Å, Crystal Structure of symmetric swapped human Nck SH3.1 domain, 0.93A, orthorhombic form IV
5QU3 1.02 Å, Crystal Structure of domain swapped human Nck SH3.1, 1.01A, monoclinic
5QU2 1.04 Å, Crystal Structure of human Nck SH3.1 in complex with peptide PPPVPNPDY
5QU4 1.05 Å, Crystal Structure of swapped human Nck SH3.1 domain, 1.05A, orthorhombic form I
5QU1 1.08 Å, Crystal Structure of the monomeric human Nck SH3.1 domain, triclinic, 1.08A
5QU5 1.11 Å, Domain Swap in the first SH3 domain of human Nck1
5QU7 1.27 Å, Crystal Structure of swapped human Nck SH3.1 domain, 1.3A, orthorhombic form III
2CI9 1.5 Å, Nck1 SH2-domain in complex with a dodecaphosphopeptide from EPEC protein Tir
5QUA 1.51 Å, Crystal Structure of swapped human Nck SH3.1 domain, 1.5A, C2221
2CI8 1.8 Å, sh2 domain of human nck1 adaptor protein - uncomplexed
5QU6 1.82 Å, Crystal Structure of swapped human Nck SH3.1 domain, 1.8A, triclinic
2JS0 Solution structure of second SH3 domain of adaptor Nck

Browse structure collections

About this viewer

MolViewer shows 2CUB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.