Crystal Structure of symmetric swapped human Nck SH3.1 domain, 0.93A, orthorhombic form IV. Determined by X-ray diffraction at 0.93 Å resolution. Released 12 Feb 2020.
Explore 5QU8 in 3D Show helices and sheets RCSB PDB PDBe
5QU8 contains 3 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 6-9 | 4 | 1 |
| β-strand | 14 | 1 | 2 |
| β-strand | 24 | 1 | 2 |
| β-strand | 29-32 | 4 | 1 |
| α-helix | 33 | 1 | |
| α-helix | 34-36 | 3 | |
| β-strand | 39-43 | 5 | 3 |
| β-strand | 49-53 | 5 | 3 |
| α-helix | 54-56 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cytoplasmic protein NCK1 | A | protein | 87 | Homo sapiens | P16333 (AlphaFold model) |
>5QU8_1 Cytoplasmic protein NCK1 (chains A) SGGLNDIFEAQKIEWHEGSENLYFQSMAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDD SKSWWRVRNSMNKTGFVPSNYVERKNS
Small molecule AX-024 reduces T cell proliferation independently of CD3ε/Nck1 interaction, which is governed by a domain swap in the Nck1-SH3.1 domain. Richter, K., Rufer, A.C., Muller, M. et al. J Biol Chem (2020) 295:7849-7864. DOI 10.1074/jbc.RA120.012788 · PubMed
Other PDB entries of the same protein (UniProt P16333 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5QU8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.