2CZY: NRSF/REST-mSin3B PAH1 complex

Solution structure of the NRSF/REST-mSin3B PAH1 complex. Determined by solution NMR. Released 20 Dec 2005.

Method: Solution NMR
Organism: Mus musculus
Chains: 2
Atoms: 731
Mol. weight: 10.35 kDa
Released: 20 Dec 2005

Explore 2CZY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2CZY contains 5 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	34-47	14
α-helix	52-66	15
α-helix	72-82	11
α-helix	87-94	8

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	44-55	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Paired amphipathic helix protein Sin3b	A	protein	77	Mus musculus	Q62141 (AlphaFold model)
transcription factor REST (version 3)	B	protein	15		Q13127 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2CZY_1 Paired amphipathic helix protein Sin3b (chains A)
PVHVEDALTYLDQVKIRFGSDPATYNGFLEIMKEFKSQSIDTPGVIRRVSQLFHEHPDLI
VGFNAFLPLGYRIDIPK

Sequence of entity 2 (B), FASTA

>2CZY_2 transcription factor REST (version 3) (chains B)
APQLIMLANVALTGE

Primary citation

The Neural Repressor NRSF/REST Binds the PAH1 Domain of the Sin3 Corepressor by Using its Distinct Short Hydrophobic Helix. Nomura, M., Uda-Tochio, H., Murai, K. et al. J Mol Biol (2005) 354:903-915. DOI 10.1016/j.jmb.2005.10.008 · PubMed

Other PDB entries of the same protein (UniProt Q62141 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1E91 Structure of the complex of the Mad1-Sin3B interaction domains
1PD7 Extended SID of Mad1 bound to the PAH2 domain of mSin3B
2CR7 Solution structure of the first PAH domain of the mouse transcriptional repressor SIN3B
2F05 Solution structure of free PAH2 domain of mSin3B
5Y95 Haddock model of mSIN3B PAH1 domain

Browse structure collections

About this viewer

MolViewer shows 2CZY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.