2D1X: Cortactin-SH3 domain and AMAP1-peptide complex

The crystal structure of the cortactin-SH3 domain and AMAP1-peptide complex. Determined by X-ray diffraction at 1.9 Å resolution. Released 25 Apr 2006.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 6
Atoms: 2,314
Mol. weight: 32.94 kDa
Released: 25 Apr 2006

Explore 2D1X in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2D1X contains 6 α-helices and 35 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 1 helix, 9 β-strands

Element	Residues	Length	Sheet
β-strand	8-10	3	1
β-strand	14	1	2
β-strand	21	1	3
β-strand	24	1	2
β-strand	29-30	2	1
β-strand	31-34	4	3
β-strand	40-45	6	3
β-strand	48-53	6	3
α-helix	54-56	3
β-strand	57-59	3	1

Chain C: 1 helix, 9 β-strands

Element	Residues	Length	Sheet
β-strand	8-10	3	7
β-strand	14	1	8
β-strand	21	1	9
β-strand	24	1	8
β-strand	29-30	2	7
β-strand	31-35	5	9
β-strand	40-45	6	9
β-strand	48-53	6	9
α-helix	54-56	3
β-strand	57-59	3	7

Chain D: 1 helix, 8 β-strands

Element	Residues	Length	Sheet
β-strand	8-10	3	10
β-strand	14	1	11
β-strand	21	1	10
β-strand	24	1	11
β-strand	29-34	6	10
β-strand	40-45	6	10
β-strand	48-53	6	10
α-helix	54-56	3
β-strand	57-59	3	10

Chain P: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	4-10	7

Chain Q: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	5-10	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
cortactin isoform a	A, B, C, D	protein	66	Homo sapiens	Q14247 (AlphaFold model)
proline rich region from development and differentiation enhancing factor 1	P, Q	protein	15		Q9ULH1 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>2D1X_1 cortactin isoform a (chains A, B, C, D)
GPLGSENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPAN
YVELRQ

Sequence of entity 2 (P, Q), FASTA

>2D1X_2 proline rich region from development and differentiation enhancing factor 1 (chains P, Q)
SKKRPPPPPPGHKRT

Primary citation

Targeting AMAP1 and cortactin binding bearing an atypical src homology 3/proline interface for prevention of breast cancer invasion and metastasis. Hashimoto, S., Hirose, M., Hashimoto, A. et al. Proc Natl Acad Sci U S A (2006) 103:7036-7041. DOI 10.1073/pnas.0509166103 · PubMed

Other PDB entries of the same protein (UniProt Q14247 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1X69 Solution structures of the SH3 domain of human Src substrate cortactin
9EZN Canonical class 1 structure of the human cortactin SH3 domain in complex with…
9EZO Canonical class 2 structure of the human cortactin SH3 domain in complex with…
9EZP Non-canonical structure of the human cortactin SH3 domain in complex with WIP-derived…

Browse structure collections

About this viewer

MolViewer shows 2D1X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.