9EZP: PDB entry 9EZP

Non-canonical structure of the human cortactin SH3 domain in complex with WIP-derived peptide. Determined by solution NMR. Released 19 Feb 2025.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 606
Mol. weight: 8.61 kDa
Released: 19 Feb 2025

Explore 9EZP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9EZP contains 1 α-helix and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	19-22	4	1
β-strand	26	1	2
β-strand	36	1	2
β-strand	42-46	5	1
β-strand	53-57	5	1
β-strand	60-64	5	1
β-strand	69-72	4	1

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	169-175	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
cDNA FLJ34459 fis, clone HLUNG2002916, highly similar to SRC SUBSTRATE CORTACTIN	A	protein	57	Homo sapiens	Q14247 (AlphaFold model)
WAS/WASL-interacting protein family member 1	B	protein	19	Homo sapiens	O43516 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9EZP_1 cDNA FLJ34459 fis, clone HLUNG2002916, highly similar to SRC SUBSTRATE CORTACTIN (chains A)
GITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVELRQ

Sequence of entity 2 (B), FASTA

>9EZP_2 WAS/WASL-interacting protein family member 1 (chains B)
QRNRMPPPRPDVGSKPDSI

Primary citation

A Triple-pose Complex Between an Extended WIP Motif and a C-terminal SH3 Domain Modulates Cortactin Activity. Sokolik, C.G., Chill, J.H. J Mol Biol (2025) 437:168984-168984. DOI 10.1016/j.jmb.2025.168984 · PubMed

Other PDB entries of the same protein (UniProt Q14247 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2D1X 1.9 Å, The crystal structure of the cortactin-SH3 domain and AMAP1-peptide complex
1X69 Solution structures of the SH3 domain of human Src substrate cortactin
9EZN Canonical class 1 structure of the human cortactin SH3 domain in complex with…
9EZO Canonical class 2 structure of the human cortactin SH3 domain in complex with…

Browse structure collections

About this viewer

MolViewer shows 9EZP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.