9EZN: PDB entry 9EZN

Canonical class 1 structure of the human cortactin SH3 domain in complex with WIP-derived peptide. Determined by solution NMR. Released 19 Feb 2025.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 606
Mol. weight: 8.61 kDa
Released: 19 Feb 2025

Explore 9EZN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9EZN contains 1 α-helix and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	19-22	4	1
β-strand	26	1	2
β-strand	36	1	2
β-strand	41-46	6	1
β-strand	52-56	5	1
β-strand	61-65	5	1
β-strand	69-71	3	1

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	169-174	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
cDNA FLJ34459 fis, clone HLUNG2002916, highly similar to SRC SUBSTRATE CORTACTIN	A	protein	57	Homo sapiens	Q14247 (AlphaFold model)
WAS/WASL-interacting protein family member 1	B	protein	19	Homo sapiens	O43516 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9EZN_1 cDNA FLJ34459 fis, clone HLUNG2002916, highly similar to SRC SUBSTRATE CORTACTIN (chains A)
GITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVELRQ

Sequence of entity 2 (B), FASTA

>9EZN_2 WAS/WASL-interacting protein family member 1 (chains B)
QRNRMPPPRPDVGSKPDSI

Primary citation

A Triple-pose Complex Between an Extended WIP Motif and a C-terminal SH3 Domain Modulates Cortactin Activity. Sokolik, C.G., Chill, J.H. J Mol Biol (2025) 437:168984-168984. DOI 10.1016/j.jmb.2025.168984 · PubMed

Other PDB entries of the same protein (UniProt Q14247 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2D1X 1.9 Å, The crystal structure of the cortactin-SH3 domain and AMAP1-peptide complex
1X69 Solution structures of the SH3 domain of human Src substrate cortactin
9EZO Canonical class 2 structure of the human cortactin SH3 domain in complex with…
9EZP Non-canonical structure of the human cortactin SH3 domain in complex with WIP-derived…

Browse structure collections

About this viewer

MolViewer shows 9EZN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.