2D2P: Micelle-bound peptide

The solution structure of micelle-bound peptide. Determined by solution NMR. Released 26 Sept 2006.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 320
Mol. weight: 4.55 kDa
Released: 26 Sept 2006

Explore 2D2P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2D2P contains 1 α-helix and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	6-36	31

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Pituitary adenylate cyclase activating polypeptide-38	A	protein	39	Homo sapiens	P18509 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2D2P_1 Pituitary adenylate cyclase activating polypeptide-38 (chains A)
HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKX

Primary citation

The solution structure of micelle-bound peptide. Tateishi, Y., Jee, J.G., Inooka, H. et al. To be published.

Other PDB entries of the same protein (UniProt P18509 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8E3X 2.3 Å, Cryo-EM structure of the PAC1R-PACAP27-Gs complex
8E3Y 2.3 Å, Cryo-EM structure of the VPAC1R-PACAP27-Gs complex
7VQX 2.74 Å, Cryo-EM structure of human vasoactive intestinal polypeptide receptor 2 (VIP2R) in…
27EM 3.0 Å, Cryo_EM structure of PACAP27_PAC1R_Beta_arrestin 1 complex
9P94 3.0 Å, Cryo-EM structure of the PAC1sR-PACAP27-Gs complex
6P9Y 3.01 Å, PAC1 GPCR Receptor complex
6VN7 3.2 Å, Cryo-EM structure of an activated VIP1 receptor-G protein complex
7WBJ 3.42 Å, Cryo-EM structure of N-terminal modified human vasoactive intestinal polypeptide…
6M1I 3.5 Å, CryoEM structure of human PAC1 receptor in complex with PACAP38
6LPB 3.9 Å, Cryo-EM structure of the human PAC1 receptor coupled to an engineered heterotrimeric G…
1GEA Receptor-bound conformation of PACAP21
2JOD Pac1-Rshort N-terminal EC domain Pacap(6-38) complex

Browse structure collections

About this viewer

MolViewer shows 2D2P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.