2D2Q: Dimerized radixin FERM domain

Crystal structure of the dimerized radixin FERM domain. Determined by X-ray diffraction at 2.8 Å resolution. Released 18 Apr 2006.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Mus musculus
Chains: 2
Atoms: 5,016
Mol. weight: 73.56 kDa
Released: 18 Apr 2006

Explore 2D2Q in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2D2Q contains 21 α-helices and 34 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	5-10	6	1
β-strand	15-20	6	1
β-strand	25	1	2
α-helix	26-37	12
β-strand	45-50	6	1
β-strand	51	1	3
β-strand	56-58	3	1
α-helix	59-60	2
β-strand	64	1	2
β-strand	70	1	3
β-strand	76-82	7	1
α-helix	89-92	4
α-helix	96-111	16
α-helix	119-134	16
α-helix	155-158	4
α-helix	165-177	13
α-helix	184-195	12
β-strand	204-209	6	4
β-strand	215-221	7	4
β-strand	224-229	6	4
β-strand	236-241	6	4
β-strand	245-251	7	4
β-strand	254-259	6	4
β-strand	267-270	4	4
α-helix	274-295	22

Chain B: 12 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	7	1	5
β-strand	8-10	3	6
β-strand	18	1	5
β-strand	25	1	7
α-helix	26-37	12
α-helix	42-44	3
β-strand	45-50	6	6
β-strand	51	1	8
β-strand	56-58	3	6
α-helix	59-60	2
β-strand	64	1	7
β-strand	70	1	8
β-strand	77-82	6	6
α-helix	89-92	4
α-helix	96-111	16
α-helix	119-134	16
α-helix	155-158	4
α-helix	165-176	12
α-helix	177-179	3
α-helix	184-195	12
β-strand	203-210	8	9
β-strand	215-221	7	9
β-strand	224-229	6	9
β-strand	238-241	4	9
β-strand	245-251	7	9
β-strand	254-259	6	9
α-helix	265-266	2
β-strand	267-270	4	9
α-helix	274-294	21
β-strand	298-301	4	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Radixin	A, B	protein	310	Mus musculus	P26043 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2D2Q_1 Radixin (chains A, B)
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLK
LNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPE
TAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHR
GMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTI
EVQQMKAQAR

Primary citation

Structure of dimerized radixin FERM domain suggests a novel masking motif in C-terminal residues 295-304. Kitano, K., Yusa, F., Hakoshima, T. Acta Crystallogr Sect F Struct Biol Cryst Commun (2006) 62:340-345. DOI 10.1107/S1744309106010062 · PubMed

Other PDB entries of the same protein (UniProt P26043 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2ZPY 2.1 Å, Crystal structure of the mouse radxin FERM domain complexed with the mouse CD44…
3X23 2.4 Å, Radixin complex
1J19 2.4 Å, Crystal structure of the radxin FERM domain complexed with the ICAM-2 cytoplasmic peptide
2D10 2.5 Å, Crystal structure of the Radixin FERM domain complexed with the NHERF-1 C-terminal tail…
1GC7 2.8 Å, Crystal structure of the radixin ferm domain
2EMT 2.8 Å, Crystal Structure Analysis of the radixin FERM domain complexed with adhesion molecule…
2D11 2.81 Å, Crystal structure of the Radixin FERM domain complexed with the NHERF-2 C-terminal tail…
1GC6 2.9 Å, Crystal structure of the radixin ferm domain complexed with inositol-(1,4,5)-triphosphate
2EMS 2.9 Å, Crystal Structure Analysis of the radixin FERM domain complexed with adhesion molecule…
2YVC 3.2 Å, Crystal structure of the Radixin FERM domain complexed with the NEP cytoplasmic tail

Browse structure collections

About this viewer

MolViewer shows 2D2Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.