2D8B: Second tandem cofilin-domain of mouse twinfilin

Solution structure of the second tandem cofilin-domain of mouse twinfilin. Determined by solution NMR. Released 2 Jun 2006.

Method: Solution NMR
Organism: Mus musculus
Chains: 1
Atoms: 1,326
Mol. weight: 18.89 kDa
Released: 2 Jun 2006

Explore 2D8B in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2D8B contains 7 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	27-28	2
β-strand	29	1	1
α-helix	30	1
α-helix	31-41	11
β-strand	49-53	5	1
β-strand	58-63	6	1
α-helix	72-75	4
β-strand	82-92	11	1
β-strand	95-105	11	1
α-helix	113-121	9
α-helix	124-130	7
β-strand	140-144	5	1
α-helix	152-160	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Twinfilin-1	A	protein	166	Mus musculus	Q91YR1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2D8B_1 Twinfilin-1 (chains A)
GSSGSSGEVQTDVSVDTKHQTLQGVAFPISRDAFQALEKLSKKQLNYVQLEIDIKNETII
LANTENTELRDLPKRIPKDSARYHFFLYKHSHEGDYLESVVFIYSMPGYTCSIRERMLYS
SCKSPLLEIVERQLQMDVIRKIEIDNGDELTADFLYDEVHSGPSSG

Primary citation

NMR solution structures of actin depolymerizing factor homology domains. Goroncy, A.K., Koshiba, S., Tochio, N. et al. Protein Sci (2009) 18:2384-2392. DOI 10.1002/pro.248 · PubMed

Other PDB entries of the same protein (UniProt Q91YR1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1M4J 1.6 Å, Crystal structure of the N-terminal adf-H domain of mouse twinfilin isoform-1
7DS6 1.69 Å, Crystal structure of actin capping protein in complex with twinflin-1/CD2AP CPI chimera…
7DS4 1.85 Å, Crystal structure of actin capping protein in complex with twinflin-1 C-terminus tail…
6RSW 1.95 Å, HFD domain of mouse CAP1 bound to the pointed end of G-actin
7DS2 1.95 Å, Crystal structure of actin capping protein in complex with twinflin-1 C-terminus tail
7DS8 1.95 Å, Crystal structure of actin capping protein in complex with twinflin-1/CD2AP CPI chimera…
7DSB 2.44 Å, Crystal structure of actin capping protein in complex with V-1 and twinfilin C-terminal…
3DAW 2.55 Å, Structure of the actin-depolymerizing factor homology domain in complex with actin
6YP9 2.56 Å, Rabbit muscle actin in complex with ADF-H and ATP-ATTO-488
2HD7 Solution structure of C-teminal domain of twinfilin-1.

Browse structure collections

About this viewer

MolViewer shows 2D8B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.