2D9U: Chromo domain of chromobox homolog 2 from human

Solution structure of the Chromo domain of chromobox homolog 2 from human. Determined by solution NMR. Released 2 Jan 2007.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 589
Mol. weight: 8.37 kDa
Released: 2 Jan 2007

Explore 2D9U in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2D9U contains 2 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	13-22	10	1
β-strand	25-32	8	1
β-strand	41-44	4	1
α-helix	45-47	3
α-helix	51-64	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chromobox protein homolog 2 (isoform 2)	A	protein	74	Homo sapiens	Q14781 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2D9U_1 Chromobox protein homolog 2 (isoform 2) (chains A)
GSSGSSGEQVFAAECILSKRLRKGKLEYLVKWRGWSSKHNSWEPEENILDPRLLLAFQKK
EHEKEVQNSGPSSG

Primary citation

Solution structure of the Chromo domain of chromobox homolog 2 from human. Li, H., Saito, K., Koshiba, S. et al. To be published.

Other PDB entries of the same protein (UniProt Q14781 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3H91 1.5 Å, Crystal structure of the complex of human chromobox homolog 2 (CBX2) and H3K27 peptide
5EPK 1.8 Å, Crystal Structure of chromodomain of CBX2 in complex with inhibitor UNC3866

Browse structure collections

About this viewer

MolViewer shows 2D9U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.