Solution structure of the PH domain of Rho GTPase activating protein 21 from human. Determined by solution NMR. Released 24 Sept 2006.
Explore 2DHJ in 3D Show helices and sheets RCSB PDB PDBe
2DHJ contains 2 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 11-17 | 7 | 1 |
| β-strand | 21 | 1 | 1 |
| β-strand | 36-43 | 8 | 1 |
| β-strand | 46-50 | 5 | 1 |
| α-helix | 64-65 | 2 | |
| β-strand | 66-67 | 2 | 1 |
| β-strand | 71-74 | 4 | 1 |
| β-strand | 85-90 | 6 | 1 |
| β-strand | 94-98 | 5 | 1 |
| α-helix | 102-116 | 15 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Rho GTPase activating protein 21 | A | protein | 125 | Homo sapiens | Q5T5U3 (AlphaFold model) |
>2DHJ_1 Rho GTPase activating protein 21 (chains A) GSSGSSGDAAKEGWLHFRPLVTDKGKRVGGSIRPWKQMYVVLRGHSLYLYKDKREQTTPS EEEQPISVNACLIDISYSETKRKNVFRLTTSDCECLFQAEDRDDMLAWIKTIQESSNLNS GPSSG
Solution structure of the PH domain of Rho GTPase activating protein 21 from human. Li, H., Tochio, N., Koshiba, S. et al. To be published.
Other PDB entries of the same protein (UniProt Q5T5U3 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2DHJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.