Solution Structure of PDZ domain of Rho GTPase Activating Protein 21. Determined by solution NMR. Released 8 Apr 2008.
Explore 2YUY in 3D Show helices and sheets RCSB PDB PDBe
2YUY contains 4 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 12-15 | 4 | 1 |
| β-strand | 21 | 1 | 2 |
| β-strand | 23 | 1 | 2 |
| β-strand | 25 | 1 | 3 |
| β-strand | 65 | 1 | 3 |
| α-helix | 73-77 | 5 | |
| α-helix | 83-85 | 3 | |
| β-strand | 87-88 | 2 | 1 |
| β-strand | 91-92 | 2 | 1 |
| α-helix | 98-106 | 9 | |
| β-strand | 111-115 | 5 | 1 |
| α-helix | 118-120 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Rho GTPase activating protein 21 | A | protein | 126 | Homo sapiens | Q5T5U3 (AlphaFold model) |
>2YUY_1 Rho GTPase activating protein 21 (chains A) GSSGSSGGPKTVTLKRTSQGFGFTLRHFIVYPPESAIQFSYKDEENGNRGGKQRNRLEPM DTIFVKQVKEGGPAFEAGLCTGDRIIKVNGESVIGKTYSQVIALIQNSDTTLELSVMPKD SGPSSG
Solution Structure of PDZ domain of Rho GTPase Activating Protein 21. Niraula, T.N., Yoneyama, M., Koshiba, S. et al. To be published.
Other PDB entries of the same protein (UniProt Q5T5U3 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2YUY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.