2DIW: RPR domain of Putative RNA-binding protein 16

Solution structure of the RPR domain of Putative RNA-binding protein 16. Determined by solution NMR. Released 30 Sept 2006.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,200
Mol. weight: 17.08 kDa
Released: 30 Sept 2006

Explore 2DIW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2DIW contains 11 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	11-22	12
α-helix	23-25	3
α-helix	30	1
α-helix	32-44	13
α-helix	46-48	3
α-helix	49-62	14
α-helix	65-67	3
α-helix	68-85	18
α-helix	93-106	14
α-helix	116-129	14
α-helix	134-145	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Putative RNA-binding protein 16	A	protein	152	Homo sapiens	Q9UPN6 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2DIW_1 Putative RNA-binding protein 16 (chains A)
GSSGSSGDNMEAVKTFNSELYSLNDYKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKFI
QKCKPEYKVPGLYVIDSIVRQSRHQFGQEKDVFAPRFSNNIISTFQNLYRCPGDDKSKIV
RVLNLWQKNNVFKSEIIQPLLDMAAGSGPSSG

Primary citation

Solution structure of the RPR domain of Putative RNA-binding protein 16. Dang, W., Muto, Y., Inoue, M. et al. To be published.

Other PDB entries of the same protein (UniProt Q9UPN6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3D9J 1.6 Å, Snapshots of the RNA processing factor SCAF8 bound to different phosphorylated forms of…
3D9N 1.6 Å, Snapshots of the RNA processing factor SCAF8 bound to different phosphorylated forms of…
3D9M 1.75 Å, Snapshots of the RNA processing factor SCAF8 bound to different phosphorylated forms of…
3D9I 1.91 Å, Snapshots of the RNA processing factor SCAF8 bound to different phosphorylated forms of…
3D9O 2.0 Å, Snapshots of the RNA processing factor SCAF8 bound to different phosphorylated forms of…
3D9P 2.1 Å, Snapshots of the RNA processing factor SCAF8 bound to different phosphorylated forms of…
3D9K 2.2 Å, Snapshots of the RNA processing factor SCAF8 bound to different phosphorylated forms of…
3D9L 2.2 Å, Snapshots of the RNA processing factor SCAF8 bound to different phosphorylated forms of…
9U9X 1H, 13C, and 15N resonance assignments and solution structure of the CID domain of SCAF8…

Browse structure collections

About this viewer

MolViewer shows 2DIW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.