2DKY: SAM-domain of Rho-GTPase-activating protein 7

Solution structure of the SAM-domain of Rho-GTPase-activating protein 7. Determined by solution NMR. Released 24 Apr 2007.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 710
Mol. weight: 10.2 kDa
Released: 24 Apr 2007

Explore 2DKY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2DKY contains 4 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	16-33	18
α-helix	38-43	6
α-helix	51-57	7
α-helix	63-79	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Rho-GTPase-activating protein 7	A	protein	91	Homo sapiens	Q96QB1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2DKY_1 Rho-GTPase-activating protein 7 (chains A)
GSSGSSGMCRKKPDTMILTQIEAKEACDWLRATGFPQYAQLYEDFLFPIDISLVKREHDF
LDRDAIEALCRRLNTLNKCAVMKLESGPSSG

Primary citation

Solution structure of the SAM-domain of Rho-GTPase-activating protein 7. Goroncy, A.K., Sato, M., Koshiba, S. et al. To be published.

Other PDB entries of the same protein (UniProt Q96QB1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5FZT 2.1 Å, The crystal structure of R7R8 in complex with a DLC1 fragment.
3KUQ 2.3 Å, Crystal structure of the DLC1 RhoGAP domain
7TPB 3.2 Å, p120RasGAP SH3 domain in complex with DLC1 RhoGAP domain
2GYT Solution structure of the SAM (sterile alpha motif) domain of DLC1 (deleted in liver…
2KAP Solution structure of DLC1-SAM
2LOZ The novel binding mode of DLC1 and Tensin2 PTB domain

Browse structure collections

About this viewer

MolViewer shows 2DKY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.