2DLZ: SH2 domain of human protein vav-2

Solution structure of the SH2 domain of human protein vav-2. Determined by solution NMR. Released 3 Apr 2007.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 954
Mol. weight: 13.53 kDa
Released: 3 Apr 2007

Explore 2DLZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2DLZ contains 3 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	13-15	3
β-strand	19-21	3	1
α-helix	25-34	10
β-strand	39	1	2
β-strand	40-43	4	1
β-strand	52-57	6	1
β-strand	62-67	6	1
β-strand	68-70	3	3
β-strand	73-75	3	3
β-strand	82	1	3
α-helix	85-92	8
β-strand	110	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein vav-2	A	protein	118	Homo sapiens	P52735 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2DLZ_1 Protein vav-2 (chains A)
GSSGSSGSREIDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIKFND
EVKHIKVVEKDNWIHITEAKKFDSLLELVEYYQCHSLKESFKQLDTTLKYPYSGPSSG

Primary citation

Solution structure of the SH2 domain of human protein vav-2. Endo, H., Hayashi, F., Yoshida, M. et al. To be published.

Other PDB entries of the same protein (UniProt P52735 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4ROJ 1.95 Å, Crystal Structure of the VAV2 SH2 domain in complex with TXNIP phosphorylated peptide
7RNV 2.15 Å, SH2 domain of guanine nucleotide exchange factor Vav2 in complex with an actin peptide…
7WFY 2.45 Å, Crystal Structure of the VAV2 SH2 domain in complex with APP phosphorylated peptide
2DM1 Solution structure of the second SH3 domain of human protein vav-2
2LNW Identification and structural basis for a novel interaction between Vav2 and Arap3
2LNX Solution structure of Vav2 SH2 domain

Browse structure collections

About this viewer

MolViewer shows 2DLZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.