SH2 domain of guanine nucleotide exchange factor Vav2 in complex with an actin peptide with phosphorylated tyrosine 53. Determined by X-ray diffraction at 2.15 Å resolution. Released 11 Aug 2021.
Explore 7RNV in 3D Show helices and sheets RCSB PDB PDBe
7RNV contains 5 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 668-670 | 3 | |
| β-strand | 674-677 | 4 | 1 |
| α-helix | 680-687 | 8 | |
| α-helix | 691 | 1 | |
| β-strand | 694-699 | 6 | 1 |
| β-strand | 707-713 | 7 | 1 |
| β-strand | 716-721 | 6 | 1 |
| β-strand | 723-725 | 3 | 2 |
| β-strand | 728-732 | 5 | 2 |
| β-strand | 735-737 | 3 | 2 |
| α-helix | 740-749 | 10 | |
| α-helix | 752-754 | 3 | |
| β-strand | 765-766 | 2 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Guanine nucleotide exchange factor VAV2 | A | protein | 118 | Homo sapiens | P52735 (AlphaFold model) |
| Actin, alpha skeletal muscle | B | protein | 9 | Homo sapiens | P68133 (AlphaFold model) |
>7RNV_1 Guanine nucleotide exchange factor VAV2 (chains A) GPLGSEIDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIKFNDEVKH IKVVEKDNWIHITEAKKFDSLLELVEYYQCHSLKESFKQLDTTLKYPYKSRERSAGIL
>7RNV_2 Actin, alpha skeletal muscle (chains B) KDSYVGDEA
The Functional Analysis of a Major Tyrosine Phosphorylation Site on Actin. Amelie, A., Dai, S., Shen, X. et al. To be published.
Other PDB entries of the same protein (UniProt P52735 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7RNV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.