4ROJ: VAV2 SH2 domain

Crystal Structure of the VAV2 SH2 domain in complex with TXNIP phosphorylated peptide. Determined by X-ray diffraction at 1.95 Å resolution. Released 10 Dec 2014.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Homo sapiens
Chains: 6
Atoms: 3,010
Mol. weight: 45.59 kDa
Released: 10 Dec 2014

Explore 4ROJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4ROJ contains 11 α-helices and 24 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	674	1	1
α-helix	680-687	8
α-helix	691	1
β-strand	694-699	6	1
β-strand	707-713	7	1
β-strand	716-722	7	1
β-strand	723-725	3	2
β-strand	728-732	5	2
β-strand	735-737	3	2
α-helix	740-749	10
α-helix	752-754	3
β-strand	765-766	2	1

Chain C: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	674	1	5
α-helix	680-688	9
β-strand	694-699	6	5
β-strand	707-713	7	5
β-strand	716-722	7	5
β-strand	723-725	3	6
β-strand	728-732	5	6
β-strand	735-737	3	6
α-helix	740-749	10
α-helix	752-754	3
β-strand	765-766	2	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Guanine nucleotide exchange factor VAV2	A, B, C	protein	117	Homo sapiens	P52735 (AlphaFold model)
Thioredoxin-interacting protein	D, E, F	protein	14	Homo sapiens	Q9H3M7 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>4ROJ_1 Guanine nucleotide exchange factor VAV2 (chains A, B, C)
GDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIKFNDEVKHIKVVEK
DNWIHITEAKKFDSLLELVEYYQCHSLKESFKQLDTTLKYPYKSRERSASRASSRSP

Sequence of entity 2 (D, E, F), FASTA

>4ROJ_2 Thioredoxin-interacting protein (chains D, E, F)
XTPEAPPCYMDVIX

Primary citation

Crystal Structure of the VAV2 SH2 domain in complex with TXNIP phosphorylated peptide. Liu, Y., Tempel, W., Bountra, C. et al. To be published.

Other PDB entries of the same protein (UniProt P52735 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7RNV 2.15 Å, SH2 domain of guanine nucleotide exchange factor Vav2 in complex with an actin peptide…
7WFY 2.45 Å, Crystal Structure of the VAV2 SH2 domain in complex with APP phosphorylated peptide
2DLZ Solution structure of the SH2 domain of human protein vav-2
2DM1 Solution structure of the second SH3 domain of human protein vav-2
2LNW Identification and structural basis for a novel interaction between Vav2 and Arap3
2LNX Solution structure of Vav2 SH2 domain

Browse structure collections

About this viewer

MolViewer shows 4ROJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.