2DM4: Second fn3 domain of human sorLA/LR11

Solution structure of the second fn3 domain of human sorLA/LR11. Determined by solution NMR. Released 20 Oct 2006.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 809
Mol. weight: 11.49 kDa
Released: 20 Oct 2006

Explore 2DM4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2DM4 contains 1 α-helix and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 8 β-strands

Element	Residues	Length	Sheet
β-strand	12-17	6	1
β-strand	26-31	6	1
β-strand	40-49	10	2
β-strand	56-60	5	2
β-strand	64-67	4	1
β-strand	75-84	10	2
β-strand	88-91	4	2
α-helix	92	1
β-strand	95-98	4	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sortilin-related receptor	A	protein	108	Homo sapiens	Q92673 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2DM4_1 Sortilin-related receptor (chains A)
GSSGSSGPDAPRNLQLSLPREAEGVIVGHWAPPIHTHGLIREYIVEYSRSGSKMWASQRA
ASNFTEIKNLLVNTLYTVRVAAVTSRGIGNWSDSKSITTIKGSGPSSG

Primary citation

Solution structure of the second fn3 domain of human sorLA/LR11. Nagashima, T., Kurosaki, C., Yoshida, M. et al. To be published.

Other PDB entries of the same protein (UniProt Q92673 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3G2S 1.7 Å, VHS Domain of human GGA1 complexed with SorLA C-terminal Peptide
3G2T 2.0 Å, VHS Domain of human GGA1 complexed with SorLA C-terminal Phosphopeptide
3WSX 2.35 Å, SorLA Vps10p domain in ligand-free form
3WSY 3.11 Å, SorLA Vps10p domain in complex with its own propeptide fragment
3WSZ 3.2 Å, SorLA Vps10p domain in complex with Abeta-derived peptide
7VT0 3.4 Å, Dimer structure of SORLA

Browse structure collections

About this viewer

MolViewer shows 2DM4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.