2DOK: PIN domain of human EST1A

Crystal structure of the PIN domain of human EST1A. Determined by X-ray diffraction at 1.8 Å resolution. Released 1 May 2007.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,959
Mol. weight: 42.22 kDa
Released: 1 May 2007

Explore 2DOK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2DOK contains 17 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	2-4	3
β-strand	7-17	11	1
α-helix	19-35	17
β-strand	39-43	5	1
α-helix	44-54	11
α-helix	65-86	22
β-strand	92-95	4	1
β-strand	101-102	2	1
α-helix	108-111	4
α-helix	119-128	10
α-helix	135-138	4
β-strand	148-156	9	1
α-helix	160-168	9
β-strand	173-174	2	1
α-helix	176-183	8

Chain B: 8 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	2-4	3
β-strand	6-17	12	2
α-helix	19-35	17
β-strand	39-43	5	2
α-helix	44-55	12
α-helix	65-86	22
β-strand	92-95	4	2
β-strand	101-102	2	2
α-helix	119-129	11
α-helix	135-138	4
β-strand	147-156	10	2
α-helix	160-168	9
β-strand	173-174	2	2
α-helix	176-183	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Telomerase-binding protein EST1A	A, B	protein	186	Homo sapiens	Q86US8 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2DOK_1 Telomerase-binding protein EST1A (chains A, B)
GSPEFMELEIRPLFLVPDTNGFIDHLASLARLLESRKYILVVPLIVINELDGLAKGQETD
HRAGGYARVVQEKARKSIEFLEQRFESRDSCLRALTSRGNELESIAFRSEDITGQLGNND
DLILSCCLHYCKDKAKDFMPASKEEPIRLLREVVLLTDDRNLRVKALTRNVPVRDIPAFL
TWAQVG

Primary citation

Crystal structure of the PIN domain of human telomerase-associated protein EST1A. Takeshita, D., Zenno, S., Lee, W.C. et al. Proteins (2007) 68:980-989. DOI 10.1002/prot.21351 · PubMed

Other PDB entries of the same protein (UniProt Q86US8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2HWW 1.8 Å, Structure of PIN domain of human SMG6
2HWX 1.9 Å, Structure of human SMG6 E1282C PIN domain mutant.
4UM2 2.1 Å, Crystal structure of the TPR domain of SMG6
8RXB 2.6 Å, Human UPF1 CH domain in complex with SMG6 peptide

Browse structure collections

About this viewer

MolViewer shows 2DOK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.