Crystal structure of the TPR domain of SMG6. Determined by X-ray diffraction at 2.1 Å resolution. Released 23 Jul 2014.
Explore 4UM2 in 3D Show helices and sheets RCSB PDB PDBe
4UM2 contains 32 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | -580-600 | 22 | |
| α-helix | 606-629 | 24 | |
| α-helix | 631-636 | 6 | |
| α-helix | 639-643 | 5 | |
| α-helix | 644-649 | 6 | |
| α-helix | 650-660 | 11 | |
| α-helix | 667-696 | 30 | |
| α-helix | 700-703 | 4 | |
| α-helix | 716-742 | 27 | |
| α-helix | 749-761 | 13 | |
| β-strand | 765 | 1 | 1 |
| α-helix | 766-778 | 13 | |
| α-helix | 782-793 | 12 | |
| β-strand | 797 | 1 | 1 |
| α-helix | 801-820 | 20 | |
| α-helix | 880-882 | 3 | |
| α-helix | 885-905 | 21 | |
| α-helix | 909-911 | 3 | |
| α-helix | 912-928 | 17 | |
| α-helix | 936-951 | 16 | |
| α-helix | 966-992 | 27 | |
| α-helix | 1001-1003 | 3 | |
| α-helix | 1006-1008 | 3 | |
| α-helix | 1009 | 1 | |
| β-strand | 1010-1011 | 2 | 2 |
| α-helix | 1012-1014 | 3 | |
| α-helix | 1017-1020 | 4 | |
| α-helix | 1023-1035 | 13 | |
| α-helix | 1037-1039 | 3 | |
| α-helix | 1043-1044 | 2 | |
| α-helix | 1053-1055 | 3 | |
| α-helix | 1057-1068 | 12 | |
| β-strand | 1071-1072 | 2 | 2 |
| β-strand | 1079 | 1 | 3 |
| β-strand | 1086-1088 | 3 | 3 |
| α-helix | 1092-1097 | 6 | |
| α-helix | 1101-1105 | 5 | |
| β-strand | 1112-1114 | 3 | 3 |
| α-helix | 1119-1139 | 21 | |
| β-strand | 1146-1149 | 4 | 4 |
| β-strand | 1152-1155 | 4 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Telomerase-binding protein EST1A | A | protein | 589 | HOMO SAPIENS | Q86US8 (AlphaFold model) |
>4UM2_1 TELOMERASE-BINDING PROTEIN EST1A (chains A) SMELHRLLRVADNQELQLSNLLSRDRISPEGLEKMAQLRAELLQLYERCILLDIEFSDNQ NVDQILWKNAFYQVIEKFRQLVKDPNVENPEQIRNRLLELLDEGSDFFDSLLQKLQVTYK FKLEDYMDGLAIRSKPLRKTVKYALISAQRCMICQGDIARYREQASDTANYGKARSWYLK AQHIAPKNGRPYNQLALLAVYTRRKLDAVYYYMRSLAASNPILTAKESLMSLFEETKRKA EQMEKKQHEEFDLSPDQWRKGKKSTFRHVGDDTTRLEIWIHPSHPRSSQGTESGKDSEQE NGLGSLSPSDLNKRFILSFLHAHGKLFTRIGMETFPAVAEKVLKEFQVLLQHSPSPIGST RMLQLMTINMFAVHNSQLKDCFSEECRSVIQEQAAALGLAMFSLLVRRCTCLLKESAKAQ LSSPEDQDDQDDIKVSSFVPDLKELLPSVKVWSDWMLGYPDTWNPPPTSLDLPSHVAVDV WSTLADFCNILTAVNQSEVPLYKDPDDDLTLLILEEDRLLSGFVPLLAAPQDPCYVEKTS DKVIAADCKRVTVLKYFLEALCGQEEPLLAFKGGKYVSVAPVPDTMGKE
Phospho-Dependent and Phospho-Independent Interactions of the Helicase Upf1 with the Nmd Factors Smg5-Smg7 and Smg6. Chakrabarti, S., Bonneau, F., Schussler, S. et al. Nucleic Acids Res (2014) 42:9447. DOI 10.1093/NAR/GKU578 · PubMed
Other PDB entries of the same protein (UniProt Q86US8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4UM2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.