2HWW: PIN domain of human SMG6

Structure of PIN domain of human SMG6. Determined by X-ray diffraction at 1.8 Å resolution. Released 14 Nov 2006.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 3
Atoms: 3,943
Mol. weight: 61.78 kDa
Released: 14 Nov 2006

Explore 2HWW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2HWW contains 21 α-helices and 19 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	1241-1250	10	1
α-helix	1252-1267	16
β-strand	1272-1276	5	1
α-helix	1277-1288	12
α-helix	1298-1319	22
β-strand	1325-1328	4	1
α-helix	1333	1
β-strand	1334-1335	2	1
α-helix	1353-1362	10
α-helix	1368-1371	4
β-strand	1382-1389	8	1
α-helix	1393-1401	9
β-strand	1406-1407	2	1
α-helix	1409-1416	8

Chain B: 7 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	1241-1250	10	2
α-helix	1252-1267	16
β-strand	1272-1276	5	2
α-helix	1277-1288	12
α-helix	1301-1319	19
β-strand	1325-1328	4	2
β-strand	1334-1335	2	2
α-helix	1353-1362	10
α-helix	1368-1370	3
β-strand	1382-1389	8	2
α-helix	1393-1401	9
β-strand	1406-1407	2	2
α-helix	1409-1416	8

Chain C: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	1242-1250	9	3
α-helix	1252-1267	16
β-strand	1272-1276	5	3
α-helix	1277-1286	10
α-helix	1304-1319	16
β-strand	1325-1328	4	3
β-strand	1334	1	3
α-helix	1354-1362	9
β-strand	1367-1368	2	3
β-strand	1382-1389	8	3
α-helix	1393-1401	9
β-strand	1406-1407	2	3
α-helix	1409-1416	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Telomerase-binding protein EST1A	A, B, C	protein	181	Homo sapiens	Q86US8 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>2HWW_1 Telomerase-binding protein EST1A (chains A, B, C)
MELEIRPLFLVPDTNGFIDHLASLARLLESRKYILVVPLIVINELDGLAKGQETDHRAGG
YARVVQEKARKSIEFLEQRFESRDSCLRALTSRGNELESIAFRSEDITGQLGNNDDLILS
CCLHYCKDKAKDFMPASKEEPIRLLREVVLLTDDRNLRVKALTRNVPVRDIPAFLTWAQV
G

Primary citation

Structures of the PIN domains of SMG6 and SMG5 reveal a nuclease within the mRNA surveillance complex. Glavan, F., Behm-Ansmant, I., Izaurralde, E. et al. EMBO J (2006) 25:5117-5125. DOI 10.1038/sj.emboj.7601377 · PubMed

Other PDB entries of the same protein (UniProt Q86US8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2DOK 1.8 Å, Crystal structure of the PIN domain of human EST1A
2HWX 1.9 Å, Structure of human SMG6 E1282C PIN domain mutant.
4UM2 2.1 Å, Crystal structure of the TPR domain of SMG6
8RXB 2.6 Å, Human UPF1 CH domain in complex with SMG6 peptide

Browse structure collections

About this viewer

MolViewer shows 2HWW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.