Docking and dimerization domain (D/D) of the Type II-alpha regulatory subunity of protein kinase A (PKA) in complex with a peptide from an A-kinase anchoring protein. Determined by solution NMR. Released 29 Aug 2006.
Explore 2DRN in 3D Show helices and sheets RCSB PDB PDBe
2DRN contains 5 α-helices and 0 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 11-25 | 15 | |
| α-helix | 30-41 | 12 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 11-25 | 15 | |
| α-helix | 30-44 | 15 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-18 | 16 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| cAMP-dependent protein kinase type II-alpha regulatory subunit | A, B | protein | 46 | Rattus norvegicus | P12368 (AlphaFold model) |
| 24-residues peptide from an a-kinase anchoring protein | C | protein | 24 | Q12802 (AlphaFold model) |
>2DRN_1 cAMP-dependent protein kinase type II-alpha regulatory subunit (chains A, B) HMGHIQIPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARR
>2DRN_2 24-residues peptide from an a-kinase anchoring protein (chains C) DLIEEAASRIVDAVIEQVKAAGAY
A novel mechanism of PKA anchoring revealed by solution structures of anchoring complexes. Newlon, M.G., Roy, M., Morikis, D. et al. EMBO J (2001) 20:1651-1662. DOI 10.1093/emboj/20.7.1651 · PubMed
Other PDB entries of the same protein (UniProt P12368 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2DRN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.