2H9R: PDB entry 2H9R

Docking and dimerization domain (D/D) of the regulatory subunit of the Type II-alpha cAMP-dependent protein kinase A associated with a Peptide derived from an A-kinase anchoring protein (AKAP). Determined by solution NMR. Released 29 Aug 2006.

Method: Solution NMR
Organism: Rattus norvegicus
Chains: 3
Atoms: 929
Mol. weight: 13.18 kDa
Released: 29 Aug 2006

Explore 2H9R in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2H9R contains 5 α-helices and 0 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	11-25	15
α-helix	30-44	15

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	11-25	15
α-helix	30-45	16

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	3-18	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
cAMP-dependent protein kinase type II-alpha regulatory subunit	A, B	protein	46	Rattus norvegicus	P12368 (AlphaFold model)
22-mer from A-kinase anchor protein 5	C	protein	22		P24588 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2H9R_1 cAMP-dependent protein kinase type II-alpha regulatory subunit (chains A, B)
HMGHIQIPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARR

Sequence of entity 2 (C), FASTA

>2H9R_2 22-mer from A-kinase anchor protein 5 (chains C)
LLIETASSLVKNAIQLSIEQLV

Primary citation

A novel mechanism of PKA anchoring revealed by solution structures of anchoring complexes. Newlon, M.G., Roy, M., Morikis, D. et al. EMBO J (2001) 20:1651-1662. DOI 10.1093/emboj/20.7.1651 · PubMed

Other PDB entries of the same protein (UniProt P12368 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2HWN 1.6 Å, Crystal Structure of RII alpha Dimerization/Docking domain of PKA bound to the D-AKAP2…
3TMH 3.8 Å, Crystal structure of dual-specific A-kinase anchoring protein 2 in complex with…
2DRN Docking and dimerization domain (D/D) of the Type II-alpha regulatory subunity of…

Browse structure collections

About this viewer

MolViewer shows 2H9R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.