2HWN: RII alpha Dimerization/Docking domain of PKA

Crystal Structure of RII alpha Dimerization/Docking domain of PKA bound to the D-AKAP2 peptide. Determined by X-ray diffraction at 1.6 Å resolution. Released 21 Nov 2006.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Rattus norvegicus
Chains: 6
Atoms: 1,853
Mol. weight: 26.47 kDa
Released: 21 Nov 2006

Explore 2HWN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2HWN contains 11 α-helices and 0 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and D: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	9-23	15
α-helix	28-42	15

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	9-23	15
α-helix	28-43	16

Chain C: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	5-6	2
α-helix	9-23	15
α-helix	28-42	15

Chain E: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	4-19	16

Chain F: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	4-20	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
cAMP-dependent protein kinase type II-alpha regulatory subunit	A, B, C, D	protein	45	Rattus norvegicus	P12368 (AlphaFold model)
A Kinase binding peptide	E, F	protein	22		Q4R5S0 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>2HWN_1 cAMP-dependent protein kinase type II-alpha regulatory subunit (chains A, B, C, D)
MSHIQIPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARR

Sequence of entity 2 (E, F), FASTA

>2HWN_2 A Kinase binding peptide (chains E, F)
QEELAWKIAKMIVSDVMQQCKK

Primary citation

A Dynamic Mechanism for AKAP Binding to RII Isoforms of cAMP-Dependent Protein Kinase. Kinderman, F.S., Kim, C., von Daake, S. et al. Mol Cell (2006) 24:397-408. DOI 10.1016/j.molcel.2006.09.015 · PubMed

Other PDB entries of the same protein (UniProt P12368 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3TMH 3.8 Å, Crystal structure of dual-specific A-kinase anchoring protein 2 in complex with…
2DRN Docking and dimerization domain (D/D) of the Type II-alpha regulatory subunity of…
2H9R Docking and dimerization domain (D/D) of the regulatory subunit of the Type II-alpha…

Browse structure collections

About this viewer

MolViewer shows 2HWN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.