2E45: Fe65 WW domain

Solution structure of Fe65 WW domain. Determined by solution NMR. Released 26 Dec 2006.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 404
Mol. weight: 6.1 kDa
Released: 26 Dec 2006

Explore 2E45 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2E45 contains 0 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	19-24	6	1
β-strand	27-32	6	1
β-strand	38-39	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Amyloid beta A4 precursor protein-binding family B member 1	A	protein	55	Homo sapiens	O00213 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2E45_1 Amyloid beta A4 precursor protein-binding family B member 1 (chains A)
GPLGSDSFWNPNAFETDSDLPAGWMRVQDTSGTYYWHIPTGTTQWEPPGRASPSQ

Primary citation

Solution structure of Fe65 WW domain. Kouno, T., Mizuguchi, M., Nozawa, Y. et al. To be published.

Other PDB entries of the same protein (UniProt O00213 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2HO2 1.33 Å, Structure of human FE65-WW domain in complex with hMena peptide.
2OEI 1.35 Å, Crystal structure of human FE65-WW domain in complex with human Mena peptide
3DXE 2.0 Å, Crystal structure of the intracellular domain of human APP (T668A mutant) in complex…
3DXC 2.1 Å, Crystal structure of the intracellular domain of human APP in complex with Fe65-PTB2
3D8D 2.2 Å, Crystal structure of the human Fe65-PTB1 domain
3DXD 2.2 Å, Crystal structure of the intracellular domain of human APP (T668E mutant) in complex…
2IDH 2.28 Å, Crystal Structure of human FE65 WW domain
5NQH 2.6 Å, Structure of the human Fe65-PTB2 homodimer
3D8F 2.7 Å, Crystal structure of the human Fe65-PTB1 domain with bound phosphate (trigonal crystal…
3D8E 2.8 Å, Crystal structure of the human Fe65-PTB1 domain (trigonal crystal form)

Browse structure collections

About this viewer

MolViewer shows 2E45 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.