2IDH: Human FE65 WW domain

Crystal Structure of human FE65 WW domain. Determined by X-ray diffraction at 2.28 Å resolution. Released 10 Jul 2007.

Method: X-ray diffraction
Resolution: 2.28 Å
Organism: Homo sapiens
Chains: 8
Atoms: 2,217
Mol. weight: 35.11 kDa
Released: 10 Jul 2007

Explore 2IDH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2IDH contains 4 α-helices and 24 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 3 β-strands

Element	Residues	Length	Sheet
α-helix	255-256	2
β-strand	259-264	6	1
β-strand	267-272	6	1
β-strand	277-279	3	1

Chain B: 1 helix, 3 β-strands

Element	Residues	Length	Sheet
β-strand	259-264	6	1
β-strand	267-272	6	1
β-strand	277-279	3	1
α-helix	282-283	2

Chain C: 0 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	259-263	5	2
β-strand	268-272	5	2
β-strand	277-279	3	2

Chains D and H: 0 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	259-264	6	2
β-strand	267-272	6	2
β-strand	277-279	3	2

Chain E: 0 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	259-264	6	3
β-strand	267-272	6	3
β-strand	278-279	2	3

Chain F: 1 helix, 3 β-strands

Element	Residues	Length	Sheet
α-helix	255-256	2
β-strand	259-264	6	4
β-strand	267-272	6	4
β-strand	278-279	2	4

Chain G: 1 helix, 3 β-strands

Element	Residues	Length	Sheet
β-strand	259-264	6	5
β-strand	267-272	6	5
β-strand	278-279	2	5
α-helix	282-283	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Amyloid beta A4 protein-binding family B member 1	A, B, C, D, E, F, G, H	protein	38	Homo sapiens	O00213 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H), FASTA

>2IDH_1 Amyloid beta A4 protein-binding family B member 1 (chains A, B, C, D, E, F, G, H)
GSDLPAGWMRVQDTSGTYYWHIPTGTTQWEPPGRASPS

Primary citation

Structural Basis for Polyproline Recognition by the FE65 WW Domain. Meiyappan, M., Birrane, G., Ladias, J.A. J Mol Biol (2007) 372:970-980. DOI 10.1016/j.jmb.2007.06.064 · PubMed

Other PDB entries of the same protein (UniProt O00213 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2HO2 1.33 Å, Structure of human FE65-WW domain in complex with hMena peptide.
2OEI 1.35 Å, Crystal structure of human FE65-WW domain in complex with human Mena peptide
3DXE 2.0 Å, Crystal structure of the intracellular domain of human APP (T668A mutant) in complex…
3DXC 2.1 Å, Crystal structure of the intracellular domain of human APP in complex with Fe65-PTB2
3D8D 2.2 Å, Crystal structure of the human Fe65-PTB1 domain
3DXD 2.2 Å, Crystal structure of the intracellular domain of human APP (T668E mutant) in complex…
5NQH 2.6 Å, Structure of the human Fe65-PTB2 homodimer
3D8F 2.7 Å, Crystal structure of the human Fe65-PTB1 domain with bound phosphate (trigonal crystal…
3D8E 2.8 Å, Crystal structure of the human Fe65-PTB1 domain (trigonal crystal form)
2E45 Solution structure of Fe65 WW domain

Browse structure collections

About this viewer

MolViewer shows 2IDH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.