2E5P: TUDOR domain of PHD finger protein 1

Solution structure of the TUDOR domain of PHD finger protein 1 (PHF1 protein). Determined by solution NMR. Released 26 Jun 2007.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 514
Mol. weight: 7.3 kDa
Released: 26 Jun 2007

Explore 2E5P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2E5P contains 0 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	15-19	5	1
β-strand	25-34	10	1
β-strand	39-44	6	1
β-strand	48-53	6	1
β-strand	57-58	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PHD finger protein 1	A	protein	68	Homo sapiens	O43189 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2E5P_1 PHD finger protein 1 (chains A)
GSSGSSGPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQFLVLWKDISPA
ALSGPSSG

Primary citation

Solution structure of the TUDOR domain of PHD finger protein 1 (PHF1 protein). Dang, W., Muto, Y., Inoue, M. et al. To be published.

Other PDB entries of the same protein (UniProt O43189 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6WAV 1.7 Å, Crystal structure of PHF1 in complex with H3K36me3 substitution
6WAT 1.8 Å, complex structure of PHF1
4HCZ 1.85 Å, PHF1 Tudor in complex with H3K36me3
7LKY 1.85 Å, Crystal Structure of PHF1 Tudor domain in complex with a peptidomimetic ligand UNC6641
5XFN 1.9 Å, Structure of the N-terminal domains of PHF1
5XFO 1.9 Å, Structure of the N-terminal domains of PHF1
5XFP 2.3 Å, Binary complex of PHF1 and a double stranded DNA
8H43 2.3 Å, Crystal structure of PHF1 Tudor domain in complex with hit 1
2M0O The solution structure of human PHF1 in complex with H3K36me3

Browse structure collections

About this viewer

MolViewer shows 2E5P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.