2EBO: Core structure of GP2 from ebola virus

Name: PDB 2EBO: Core structure of GP2 from ebola virus
Published: 1999-05-18
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: envelope glycoprotein

Core structure of GP2 from ebola virus. Determined by X-ray diffraction at 1.9 Å resolution. Released 18 May 1999.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Zaire ebolavirus - Mayinga (Zaire, 1976)
Chains: 3
Atoms: 2,021
Mol. weight: 25.67 kDa
Released: 18 May 1999

Explore 2EBO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2EBO contains 14 α-helices and 0 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	560-594	35
α-helix	595-597	3
α-helix	600-604	5
α-helix	605-609	5
α-helix	616-628	13

Chain B: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	561-593	33
α-helix	595-597	3
α-helix	601-604	4
α-helix	616-627	12

Chain C: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	561-594	34
α-helix	595-597	3
α-helix	600-604	5
α-helix	605-609	5
α-helix	616-629	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ebola virus envelope glycoprotein	A, B, C	protein	74	Zaire ebolavirus - Mayinga (Zaire, 1976)	Q05320 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>2EBO_1 EBOLA VIRUS ENVELOPE GLYCOPROTEIN (chains A, B, C)
GLRQLANETTQALQLFLRATTELRTFSILNRKAIDFLLQRWGGTCHILGPDCAIEPHDWT
KNITDKIDQIIHDF

Primary citation

Core structure of the envelope glycoprotein GP2 from Ebola virus at 1.9-A resolution. Malashkevich, V.N., Schneider, B.J., McNally, M.L. et al. Proc Natl Acad Sci U S A (1999) 96:2662-2667. DOI 10.1073/pnas.96.6.2662 · PubMed

Other PDB entries of the same protein (UniProt Q05320 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6HS4 2.05 Å, Crystal structure of Ebolavirus glycoprotein in complex with inhibitor 118
6F5U 2.07 Å, Crystal structure of ebolavirus glycoprotein in complex with bepridil
6F6N 2.15 Å, Crystal structure of ebolavirus glycoprotein in complex with sertraline
6G9I 2.19 Å, Crystal structure of Ebolavirus glycoprotein in complex with clomipramine
5JQ3 2.23 Å, Crystal structure of Ebola glycoprotein
7SSQ 2.25 Å, Crystal Structure of Ebola zaire Envelope glycoprotein GP in complex with compound…
6G9B 2.26 Å, Crystal structure of Ebolavirus glycoprotein in complex with imipramine
7JPI 2.28 Å, Crystal structure of EBOV glycoprotein with modified HR2 stalk at 2.3A resolution
6F6S 2.29 Å, CRYSTAL STRUCTURE OF EBOLAVIRUS GLYCOPROTEIN IN COMPLEX WITH benztropine
6HRO 2.3 Å, Crystal structure of Ebolavirus glycoprotein in complex with inhibitor 118a
6G95 2.31 Å, Crystal structure of Ebolavirus glycoprotein in complex with thioridazine
7LYD 2.35 Å, Crystal Structure of Ebola zaire Envelope glycoprotein GP in complex with compound…

Browse structure collections

About this viewer

MolViewer shows 2EBO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.