Solution structure of the second zf-RanBP domain from human Nuclear pore complex protein Nup153. Determined by solution NMR. Released 14 Aug 2007.
Explore 2EBQ in 3D Show helices and sheets RCSB PDB PDBe
2EBQ contains 4 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 12-13 | 2 | 1 |
| β-strand | 20-21 | 2 | 1 |
| β-strand | 27 | 1 | 2 |
| α-helix | 33 | 1 | |
| β-strand | 34 | 1 | 2 |
| α-helix | 35 | 1 | |
| α-helix | 41-43 | 3 | |
| α-helix | 45-46 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Nuclear pore complex protein Nup153 | A | protein | 47 | Homo sapiens | P49790 (AlphaFold model) |
>2EBQ_1 Nuclear pore complex protein Nup153 (chains A) GSSGSSGVIGTWDCDTCLVQNKPEAIKCVACETPKPGTCVKRALTLT
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 1 |
Solution structure of the second zf-RanBP domain from human Nuclear pore complex protein Nup153. Zhang, H.P., Kurosaki, C., Yoshida, M. et al. To be published.
Other PDB entries of the same protein (UniProt P49790 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2EBQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.