2EBQ: Nuclear pore complex protein Nup153

Solution structure of the second zf-RanBP domain from human Nuclear pore complex protein Nup153. Determined by solution NMR. Released 14 Aug 2007.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 333
Mol. weight: 4.9 kDa
Ligands: ZN
Released: 14 Aug 2007

Explore 2EBQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2EBQ contains 4 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	12-13	2	1
β-strand	20-21	2	1
β-strand	27	1	2
α-helix	33	1
β-strand	34	1	2
α-helix	35	1
α-helix	41-43	3
α-helix	45-46	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nuclear pore complex protein Nup153	A	protein	47	Homo sapiens	P49790 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2EBQ_1 Nuclear pore complex protein Nup153 (chains A)
GSSGSSGVIGTWDCDTCLVQNKPEAIKCVACETPKPGTCVKRALTLT

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Primary citation

Solution structure of the second zf-RanBP domain from human Nuclear pore complex protein Nup153. Zhang, H.P., Kurosaki, C., Yoshida, M. et al. To be published.

Other PDB entries of the same protein (UniProt P49790 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4U0C 1.77 Å, Hexameric HIV-1 CA in complex with Nup153 peptide, P6 crystal form
5TSX 1.9 Å, HIV-1 CA hexamer with NUP153 peptide - P1 crystal form
6AYA 2.4 Å, Structure of the native full-length HIV-1 capsid protein in complex with Nup153 peptide
5TSV 2.5 Å, HIV-1 CA hexamer with NUP153 peptide - R3 crystal form
8CKY 2.6 Å, HIV-1 mature capsid hexamer from CA-IP6 CLPs, bound to Nup153 peptide
9S6N 2.6 Å, HIV-1 capsid (M-group) - Nup153
9CNU 2.99 Å, HIV-2 CA hexamer bound with Nup153 peptide; assembled with liposome templating
4U0D 3.0 Å, Hexameric HIV-1 CA in complex with Nup153 peptide, P212121 crystal form
8CL0 3.12 Å, HIV-1 mature capsid hexamer next to pentamer (type I) from CA-IP6 CLPs bound to Nup153…
2EBR Solution structure of the fourth zf-RanBP domain from human Nuclear pore complex protein…
2EBV Solution structure of the third zf-RanBP domain from human Nuclear pore complex protein…
2GQE Molecular characterization of the Ran binding zinc finger domain

Browse structure collections

About this viewer

MolViewer shows 2EBQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.