2GQE: Nuclear pore complex protein Nup153

Molecular characterization of the Ran binding zinc finger domain. Determined by solution NMR. Released 10 Apr 2007.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 240
Mol. weight: 3.56 kDa
Ligands: ZN
Released: 10 Apr 2007

Explore 2GQE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2GQE contains 0 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	7-8	2	1
β-strand	15-16	2	1
β-strand	22	1	2
β-strand	29	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nuclear pore complex protein Nup153	A	protein	32	Homo sapiens	P49790 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2GQE_1 Nuclear pore complex protein Nup153 (chains A)
GHMVIGTWDCDTCLVQNKPEAIKCVACETPKP

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Primary citation

Molecular Characterization of the Ran-binding Zinc Finger Domain of Nup153. Higa, M.M., Alam, S.L., Sundquist, W.I. et al. J Biol Chem (2007) 282:17090-17100. DOI 10.1074/jbc.M702715200 · PubMed

Other PDB entries of the same protein (UniProt P49790 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4U0C 1.77 Å, Hexameric HIV-1 CA in complex with Nup153 peptide, P6 crystal form
5TSX 1.9 Å, HIV-1 CA hexamer with NUP153 peptide - P1 crystal form
6AYA 2.4 Å, Structure of the native full-length HIV-1 capsid protein in complex with Nup153 peptide
5TSV 2.5 Å, HIV-1 CA hexamer with NUP153 peptide - R3 crystal form
8CKY 2.6 Å, HIV-1 mature capsid hexamer from CA-IP6 CLPs, bound to Nup153 peptide
9S6N 2.6 Å, HIV-1 capsid (M-group) - Nup153
9CNU 2.99 Å, HIV-2 CA hexamer bound with Nup153 peptide; assembled with liposome templating
4U0D 3.0 Å, Hexameric HIV-1 CA in complex with Nup153 peptide, P212121 crystal form
8CL0 3.12 Å, HIV-1 mature capsid hexamer next to pentamer (type I) from CA-IP6 CLPs bound to Nup153…
2EBQ Solution structure of the second zf-RanBP domain from human Nuclear pore complex protein…
2EBR Solution structure of the fourth zf-RanBP domain from human Nuclear pore complex protein…
2EBV Solution structure of the third zf-RanBP domain from human Nuclear pore complex protein…

Browse structure collections

About this viewer

MolViewer shows 2GQE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.