4U0C: Hexameric HIV-1 CA

Hexameric HIV-1 CA in complex with Nup153 peptide, P6 crystal form. Determined by X-ray diffraction at 1.77 Å resolution. Released 12 Nov 2014.

Method: X-ray diffraction
Resolution: 1.77 Å
Organisms: Human immunodeficiency virus type 1 group M subtype B, Homo sapiens
Chains: 2
Atoms: 1,910
Mol. weight: 27.15 kDa
Released: 12 Nov 2014

Explore 4U0C in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4U0C contains 14 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	2-4	3	1
β-strand	10-12	3	1
α-helix	14-16	3
α-helix	17-30	14
α-helix	36-43	8
α-helix	49-57	9
α-helix	63-83	21
α-helix	96-100	5
α-helix	101-104	4
α-helix	111-118	8
α-helix	126-144	19
α-helix	150-152	3
α-helix	161-175	15
α-helix	189-192	4
α-helix	196-205	10
α-helix	211-217	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Capsid protein p24	A	protein	231	Human immunodeficiency virus type 1 group M subtype B	P12493
Nuclear pore complex protein Nup153	B	protein	17	Homo sapiens	P49790 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4U0C_1 Capsid protein p24 (chains A)
PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVG
GHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTH
NPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQE
VKNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKARVL

Sequence of entity 2 (B), FASTA

>4U0C_2 Nuclear pore complex protein Nup153 (chains B)
TNNSPSGVFTFGANSST

Primary citation

Host Cofactors and Pharmacologic Ligands Share an Essential Interface in HIV-1 Capsid That Is Lost upon Disassembly. Price, A.J., Jacques, D.A., McEwan, W.A. et al. PLoS Pathog (2014) 10:e1004459-e1004459. DOI 10.1371/journal.ppat.1004459 · PubMed

Other PDB entries of the same protein (UniProt P12493), best resolution first:

8QUK 1.38 Å, Hexameric HIV-1 CA in complex with DDD00100439
8QUH 1.55 Å, Hexameric HIV-1 CA in complex with DDD00057456
8FIU 1.56 Å, Potent long-acting inhibitors targeting HIV-1 capsid based on a versatile…
8QUB 1.63 Å, Hexameric HIV-1 CA in complex with DDD00074110
8QUJ 1.63 Å, Hexameric HIV-1 CA in complex with DDD00100452
8QUL 1.67 Å, Hexameric HIV-1 CA in complex with DDD00100555
8QUI 1.69 Å, Hexameric HIV-1 CA in complex with DDD00024969
5JPA 1.7 Å, Hexameric HIV-1 CA H12Y mutant
8QV9 1.76 Å, Hexameric HIV-1 CA in complex with DDD01829021
8VRP 1.8 Å, HIV-CA Disulfide linked Hexamer bound to 4-Quinazolinone Scaffold inhibitor
8QUY 1.88 Å, Hexameric HIV-1 CA in complex with DDD01728501
5TSX 1.9 Å, HIV-1 CA hexamer with NUP153 peptide - P1 crystal form

Browse structure collections

About this viewer

MolViewer shows 4U0C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.