2ENO: Synaptojanin-2-binding protein

Solution structure of the PDZ domain from human Synaptojanin 2 binding protein. Determined by solution NMR. Released 2 Oct 2007.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 891
Mol. weight: 12.69 kDa
Released: 2 Oct 2007

Explore 2ENO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2ENO contains 2 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	14-24	11	1
β-strand	32-35	4	1
β-strand	49-54	6	1
α-helix	59-62	4
β-strand	71-75	5	1
β-strand	78-79	2	1
α-helix	85-95	11
β-strand	98-108	11	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Synaptojanin-2-binding protein	A	protein	120	Homo sapiens	P57105 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2ENO_1 Synaptojanin-2-binding protein (chains A)
GSSGSSGMNGRVDYLVTEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKENGAA
ALDGRLQEGDKILSVNGQDLKNLLHQDAVDLFRNAGYAVSLRVQHRLQVQNGPISGPSSG

Primary citation

Solution structure of the PDZ domain from human Synaptojanin 2 binding protein. Endo, H., Yoshida, M., Hayashi, F. et al. To be published.

Other PDB entries of the same protein (UniProt P57105 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2JIK 1.35 Å, Crystal structure of PDZ domain of Synaptojanin-2 binding protein
2JIN 1.5 Å, Crystal structure of PDZ domain of Synaptojanin-2 binding protein
7P73 1.85 Å, The PDZ domain of SYNJ2BP complexed with the PDZ-binding motif of HTLV1-TAX1
7P74 1.9 Å, The PDZ domain of SYNJ2BP complexed with the phosphorylated PDZ-binding motif of RSK1
8AEL 2.2 Å, SYNJ2BP complex with a synthetic Vangl2 peptide (3mer).
7PC9 2.4 Å, The PDZ domain of SYNJ2BP complexed with the PDZ-binding motif of HTLV1-TAX1
7R2M 2.4 Å, SYNJ2BP complex with a synthetic Vangl2 peptide (9mer).
7R2T 2.5 Å, SYNJ2BP complex with a phosphorylated Vangl2 peptide at the P-1 position.

Browse structure collections

About this viewer

MolViewer shows 2ENO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.