2F1W: TRAF-like domain of HAUSP/USP7

Crystal structure of the TRAF-like domain of HAUSP/USP7. Determined by X-ray diffraction at 1.65 Å resolution. Released 7 Feb 2006.

Method: X-ray diffraction
Resolution: 1.65 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,335
Mol. weight: 18.57 kDa
Ligands: CA
Released: 7 Feb 2006

Explore 2F1W in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2F1W contains 4 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	68-75	8	1
α-helix	78-80	3
β-strand	85-86	2	2
α-helix	87-89	3
β-strand	90-92	3	2
β-strand	95-105	11	2
β-strand	113-121	9	2
β-strand	132-140	9	1
α-helix	146-148	3
β-strand	150-158	9	1
β-strand	159	1	3
β-strand	162	1	3
β-strand	164-172	9	2
α-helix	173-176	4
β-strand	185	1	4
β-strand	188	1	4
β-strand	189-197	9	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin carboxyl-terminal hydrolase 7	A	protein	158	Homo sapiens	Q93009 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2F1W_1 Ubiquitin carboxyl-terminal hydrolase 7 (chains A)
GSHMNTAEEDMEDDTSWRSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFYPD
RPHQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDWGFS
NFMAWSEVTDPEKGFIDDDKVTFEVFVQADAPHGVAWD

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	2

Primary citation

Structural Basis of Competitive Recognition of p53 and MDM2 by HAUSP/USP7: Implications for the Regulation of the p53-MDM2 Pathway. Hu, M., Gu, L., Li, M. et al. PLoS Biol (2006) 4:e27-e27. DOI 10.1371/journal.pbio.0040027 · PubMed

Other PDB entries of the same protein (UniProt Q93009 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4YSI 1.02 Å, Structure of USP7 with a novel viral protein
5KYC 1.43 Å, Crystal structure of USP7 catalytic domain [V302K] mutant in complex with ubiquitin…
5KYF 1.45 Å, Crystal structure of USP7 catalytic domain [L299A] mutant in complex with ubiquitin
2FOJ 1.6 Å, The Crystal Structure of the N-terminal domain of HAUSP/USP7 complexed with p53 peptide…
2XXN 1.6 Å, Structure of the vIRF4-HAUSP TRAF domain complex
5KYD 1.62 Å, Crystal structure of USP7 catalytic domain [V302K] mutant in complex with ubiquitin
12ZJ 1.63 Å, Crystal structure of USP7 TRAF domain in complex with MAGEL2 peptide (968-980)
1YY6 1.7 Å, The Crystal Structure of the N-terminal domain of HAUSP/USP7 complexed with an EBNA1…
2F1Y 1.7 Å, Crystal structure of the TRAF-like domain of HAUSP/USP7 bound to a MDM2 peptide
4KG9 1.7 Å, Crystal Structure Of USP7-NTD with MCM-BP
5N9T 1.73 Å, Crystal structure of USP7 in complex with a potent, selective and reversible…
9DEM 1.77 Å, USP7 in complex with macrocycle MC04

Browse structure collections

About this viewer

MolViewer shows 2F1W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.