2FAC: E. coli hexanoyl-ACP

Crystal structure of E. coli hexanoyl-ACP. Determined by X-ray diffraction at 1.76 Å resolution. Released 26 Sept 2006.

Method: X-ray diffraction
Resolution: 1.76 Å
Organism: Escherichia coli
Chains: 2
Atoms: 1,485
Mol. weight: 18.63 kDa
Ligands: PM4, ZN
Released: 26 Sept 2006

Explore 2FAC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2FAC contains 10 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	3-15	13
α-helix	19-21	3
β-strand	27	1	1
α-helix	36-49	14
α-helix	56-60	5
β-strand	64	1	1
α-helix	65-75	11

Chain B: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	3-15	13
α-helix	19-21	3
β-strand	27	1	2
α-helix	36-50	15
α-helix	56-59	4
β-strand	64	1	2
α-helix	65-75	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Acyl carrier protein	A, B	protein	77	Escherichia coli	P0A6A8 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2FAC_1 Acyl carrier protein (chains A, B)
STIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAE
KITTVQAAIDYINGHQA

Ligands and cofactors

ID	Name	Formula	Copies
PM4	S-(2-{[N-(2-hydroxy-4-{[hydroxy(oxido)phosphino]oxy}-3,3-dimethylbutanoyl)-beta…	C17 H33 N2 O7 P S	2
ZN	Zinc ion	Zn	11

Primary citation

Structural Studies of Fatty Acyl-(Acyl Carrier Protein) Thioesters Reveal a Hydrophobic Binding Cavity that Can Expand to Fit Longer Substrates. Roujeinikova, A., Simon, W.J., Gilroy, J. et al. J Mol Biol (2007) 365:135-145. DOI 10.1016/j.jmb.2006.09.049 · PubMed

Other PDB entries of the same protein (UniProt P0A6A8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1T8K 1.1 Å, Crystal Structure of apo acyl carrier protein from E. coli
1L0I 1.2 Å, Crystal structure of butyryl-ACP I62M mutant
9KA6 1.47 Å, Crystal structure of beta-ketoacyl-ACP synthase FabH C112Q in complex with acyl-ACP from…
2FAE 1.55 Å, Crystal structure of E. coli decanoyl-ACP
6OKC 1.55 Å, Crosslinked Crystal Structure of Type II Fatty Acid Synthase Ketosynthase, FabB, and…
6UXE 1.57 Å, Structure of the human mitochondrial desulfurase complex Nfs1-ISCU2(M140I)-ISD11 with…
2FAD 1.6 Å, Crystal structure of E. coli heptanoyl-ACP
7SQI 1.7 Å, Crosslinked Crystal Structure of Type II Fatty Acid Synthase Ketosynthase, FabB, and…
6W1D 1.79 Å, Structure of human mitochondrial complex Nfs1-ISCU2 (WT)-ISD11 with E.coli ACP1 at 1.8 A…
6U0J 1.9 Å, Crosslinked Crystal Structure of Malonyl-CoA Acyl Carrier Protein Transacylase, FabD,…
6WIH 1.9 Å, N-terminal mutation of ISCU2 (L35H36) traps Nfs1 Cys loop in the active site of ISCU2…
4KEH 1.9 Å, Crosslinked Crystal Structure of Type II Fatty Synthase Dehydratase, FabA, and Acyl…

Browse structure collections

About this viewer

MolViewer shows 2FAC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.