2FCW: PDB entry 2FCW

Structure of a Complex Between the Pair of the LDL Receptor Ligand-Binding Modules 3-4 and the Receptor Associated Protein (RAP). Determined by X-ray diffraction at 1.26 Å resolution. Released 16 May 2006.

Method: X-ray diffraction
Resolution: 1.26 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,705
Mol. weight: 22.36 kDa
Ligands: CA
Released: 16 May 2006

Explore 2FCW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2FCW contains 9 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	221-231	11
α-helix	237-277	41
α-helix	283-319	37

Chain B: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	87-89	3
β-strand	92-94	3	1
β-strand	100-102	3	1
α-helix	103-105	3
α-helix	122-126	5
β-strand	131-133	3	2
β-strand	139-141	3	2
α-helix	142-144	3
α-helix	156-158	3
α-helix	160-162	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha-2-macroglobulin receptor-associated protein	A	protein	109	Homo sapiens	P30533 (AlphaFold model)
Low-density lipoprotein receptor	B	protein	80	Homo sapiens	P01130 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2FCW_1 Alpha-2-macroglobulin receptor-associated protein (chains A)
GAEFEEPRVIDLWDLAQSANLTDKELEAFREELKHFEAKIEKHNHYQKQLEIAHEKLRHA
ESVGDGERVSRSREKHALLEGRTKELGYTVKKHLQDLSGRISRARHNEL

Sequence of entity 2 (B), FASTA

>2FCW_2 Low-density lipoprotein receptor (chains B)
KTCSQAEFRCHDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWA
CDNDPDCEDGSDEWPQRCRG

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	2

Water and common crystallization additives (MPD, NA) are not listed.

Primary citation

Structure of an LDLR-RAP Complex Reveals a General Mode for Ligand Recognition by Lipoprotein Receptors. Fisher, C., Beglova, N., Blacklow, S.C. Mol Cell (2006) 22:277-283. DOI 10.1016/j.molcel.2006.02.021 · PubMed

Other PDB entries of the same protein (UniProt P30533 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9QAW 3.34 Å, CryoEM structure of the human LRP2 receptor ectodomain in complex with LRPAP1
1LRE Receptor associated protein (RAP) domain 1, NMR, 20 structures
1NRE Receptor associated protein (RAP) domain 1, NMR, minimized average structure
1OP1 Solution NMR structure of domain 1 of receptor associated protein
1OV2 Ensemble of the solution structures of domain one of receptor associated protein
2FTU solution structure of domain 3 of RAP
2FYL Haddock model of the complex between double module of LRP, CR56, and first domain of…
2P01 The structure of receptor-associated protein(RAP)
2P03 The structure of receptor-associated protein(RAP)

Browse structure collections

About this viewer

MolViewer shows 2FCW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.