2FGF: Heparin-binding growth factor 2 precursor

Name: PDB 2FGF: Three-dimensional structure of human basic fibroblast growth factor, A structural homolog of interleukin 1BETA
Published: 1992-01-15
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: growth factor

Three-dimensional structure of human basic fibroblast growth factor, A structural homolog of interleukin 1BETA. Determined by X-ray diffraction at 1.77 Å resolution. Released 15 Jan 1992.

Method: X-ray diffraction
Resolution: 1.77 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,097
Mol. weight: 16.72 kDa
Released: 15 Jan 1992

Explore 2FGF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2FGF contains 5 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	21-25	5	1
β-strand	30-34	5	1
β-strand	40-43	4	1
α-helix	49-51	3
β-strand	53-57	5	1
β-strand	62-67	6	1
β-strand	72-76	5	1
β-strand	82-85	4	1
α-helix	90-92	3
β-strand	94-98	5	1
α-helix	100-102	3
β-strand	104-108	5	1
β-strand	115	1	1
β-strand	118	1	2
β-strand	124	1	2
α-helix	127-129	3
α-helix	135-137	3
β-strand	139-143	5	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Heparin-binding growth factor 2 precursor	A	protein	146	Homo sapiens	P09038 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2FGF_1 HEPARIN-BINDING GROWTH FACTOR 2 PRECURSOR (chains A)
PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEER
GVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKR
TGQYKLGSKTGPGQKAILFLPMSAKS

Primary citation

Three-dimensional structure of human basic fibroblast growth factor, a structural homolog of interleukin 1 beta. Zhang, J.D., Cousens, L.S., Barr, P.J. et al. Proc Natl Acad Sci U S A (1991) 88:3446-3450. DOI 10.1073/pnas.88.8.3446 · PubMed

Other PDB entries of the same protein (UniProt P09038 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8OM6 1.31 Å, Crystal structure of FGF2-STAB, a stable variant of human fibroblast growth factor 2
8HU7 1.4 Å, Crystal structure of FGF2-M1 mutant - D28E/C78L/C96I/S137P
8HUE 1.48 Å, Crystal structure of FGF2-M2 mutant - D28E/C78I/C96I/S137P
4OEE 1.5 Å, Crystal Structure Analysis of FGF2-Disaccharide (S3I2) complex
1BFG 1.6 Å, Crystal structure of basic fibroblast growth factor at 1.6 Å resolution
4FGF 1.6 Å, Refinement of the structure of human basic fibroblast growth factor at 1.6 Å resolution…
4OEG 1.6 Å, Crystal Structure Analysis of FGF2-Disaccharide (S9I2) complex
4OEF 1.8 Å, Crystal Structure Analysis of FGF2-Disaccharide (S6I2) complex
1BAS 1.9 Å, Three-dimensional structures of acidic and basic fibroblast growth factors
1BFB 1.9 Å, Basic fibroblast growth factor complexed with heparin tetramer fragment
5X1O 1.9 Å, PI(4,5)P2 lipid binding induced a reorientation of FGF2 molecules near membrane surface…
1BFF 2.0 Å, The 154 amino acid form of human basic fibroblast growth factor

Browse structure collections

About this viewer

MolViewer shows 2FGF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.