2FGY: Carboxysome shell polypeptide

Beta Carbonic Anhydrase from the Carboxysomal Shell of Halothiobacillus neapolitanus (CsoSCA). Determined by X-ray diffraction at 2.2 Å resolution. Released 17 Jan 2006.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Halothiobacillus neapolitanus
Chains: 2
Atoms: 7,931
Mol. weight: 121.7 kDa
Ligands: ZN
Released: 17 Jan 2006

Explore 2FGY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2FGY contains 55 α-helices and 30 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 27 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	56-74	19
α-helix	76-85	10
α-helix	87	1
α-helix	93-104	12
α-helix	110-112	3
β-strand	116	1	1
β-strand	120	1	1
α-helix	123-141	19
α-helix	152-163	12
β-strand	165-172	8	2
β-strand	173	1	3
α-helix	176-178	3
α-helix	181-186	6
α-helix	188-190	3
β-strand	194-196	3	2
β-strand	199	1	3
α-helix	200-202	3
α-helix	206-223	18
β-strand	234-243	10	2
α-helix	254-256	3
α-helix	260-281	22
β-strand	288-296	9	2
β-strand	301-305	5	2
α-helix	306-307	2
β-strand	318-320	3	2
α-helix	321-328	8
α-helix	333-348	16
α-helix	352-354	3
α-helix	362-386	25
α-helix	390-391	2
α-helix	392-394	3
β-strand	401-405	5	4
β-strand	417-421	5	4
α-helix	426-428	3
α-helix	429-442	14
α-helix	444-446	3
β-strand	450-458	9	4
α-helix	465-483	19
α-helix	485-489	5
β-strand	493-501	9	4
α-helix	506-507	2
β-strand	508-511	4	4

Chain B: 28 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	56-74	19
α-helix	76-85	10
α-helix	87	1
α-helix	93-104	12
α-helix	110-113	4
β-strand	116	1	5
β-strand	120	1	5
α-helix	123-141	19
α-helix	152-162	11
β-strand	165-172	8	6
β-strand	173	1	7
α-helix	176-178	3
α-helix	181-185	5
α-helix	188-190	3
β-strand	194-196	3	6
β-strand	199	1	7
α-helix	200-202	3
α-helix	206-223	18
β-strand	234-243	10	6
α-helix	254-256	3
α-helix	260-281	22
β-strand	288-296	9	6
β-strand	301-305	5	6
α-helix	306-307	2
β-strand	318-320	3	6
α-helix	321-328	8
α-helix	333-347	15
α-helix	352-354	3
α-helix	359-361	3
α-helix	362-386	25
α-helix	390-391	2
α-helix	392-394	3
β-strand	401-405	5	8
β-strand	417-421	5	8
α-helix	429-442	14
α-helix	444-446	3
α-helix	448-449	2
β-strand	450-458	9	8
α-helix	465-483	19
α-helix	485-489	5
β-strand	493-501	9	8
α-helix	506-507	2
β-strand	508-511	4	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
carboxysome shell polypeptide	A, B	protein	542	Halothiobacillus neapolitanus	O85042 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2FGY_1 carboxysome shell polypeptide (chains A, B)
MSYYHHHHHHDYDIPTTENLYFQGAMGSMNTRNTRSKQRAPCGVSSSVKPRLDLIEQAPN
PVYDRHPACITLPERTCRHPLTDLEANEQLGRCEDSVKNRFDRVIPFLQVVAGIPLGLDH
VTRVQELAQSSLGHTLPEELLKDNWISGHNLKGIFGYATAKALTAATEQFSRKIMSEKDD
SASAIGFFLDCGFHAVDISPCADGRLKGLLPYILRLPLTAFTYRKAYAGSMFDIEDDLAQ
WEKNELRRYREGVPNTADQPTRYLKIAVYHFSTSDPTHSGCAAHGSNDRAALEAALTQLM
KFREAVENAHCCGASIDILLIGVDTDTDAIRVHIPDSKGFLNPYRYVDNTVTYAQTLHLA
PDEARVIIHEAILNANRSDGWAKGNGVASEGMRRFIGQLLINNLSQIDYVVNRHGGRYPP
NDIGHAERYISVGDGFDEVQIRNLAYYAHLDTVEENAIDVDVGITIFTKLNLSRGLPIPI
AIHYRYDPNVPGSRERTVVKARRIYNAIKERFSSLDEQNLLQFRLSVQAQDIGSPIEEVA
SA

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	4

Primary citation

The Structure of beta-carbonic anhydrase from the carboxysomal shell reveals a distinct subclass with one active site for the price of two. Sawaya, M.R., Cannon, G.C., Heinhorst, S. et al. J Biol Chem (2006) 281:7546-7555. DOI 10.1074/jbc.M510464200 · PubMed

Other PDB entries of the same protein (UniProt O85042 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7SMK 1.98 Å, H. neapolitanus carboxysomal rubisco/CsoSCA-peptide (1-50)complex
9SKU 2.06 Å, Cryo-EM structure of H. neapolitanus CsoSCA in reducing conditions, hexamer
7SNV 2.07 Å, H. neapolitanus carboxysomal rubisco/CsoSCA-peptide (1-50)complex
9SKX 2.08 Å, Cryo-EM structure of H. neapolitanus CsoSCA C283A/C284A inactive mutant, hexamer
9SKV 2.12 Å, Cryo-EM structure of H. neapolitanus CsoSCA in reducing conditions, dimer, major state,…
9SKR 2.13 Å, Cryo-EM structure of H. neapolitanus CsoSCA in oxidizing conditions, hexamer
9SKS 2.15 Å, Cryo-EM structure of H. neapolitanus CsoSCA in oxidizing conditions, dimer, major state,…
9SKY 2.18 Å, Cryo-EM structure of H. neapolitanus CsoSCA C283A/C284A inactive mutant, dimer, state 1
9SKZ 2.22 Å, Cryo-EM structure of H. neapolitanus CsoSCA C283A/C284A inactive mutant, dimer, state 2
9SKW 2.27 Å, Cryo-EM structure of H. neapolitanus CsoSCA in reducing conditions, dimer, minor state
9SKT 2.45 Å, Cryo-EM structure of H. neapolitanus CsoSCA in oxidizing conditions, dimer, minor state
9G4T 2.51 Å, Beta carbonic anhydrase CsoSCA from the Halothiobacillus neapolitanus alpha-carboxysome

Browse structure collections

About this viewer

MolViewer shows 2FGY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.