2FH5: Mammalian SRP Receptor

The Structure of the Mammalian SRP Receptor. Determined by X-ray diffraction at 2.45 Å resolution. Released 31 Jan 2006.

Method: X-ray diffraction
Resolution: 2.45 Å
Organisms: Homo sapiens, Mus musculus
Chains: 2
Atoms: 2,630
Mol. weight: 45.41 kDa
Ligands: GTP, MG
Released: 31 Jan 2006

Explore 2FH5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2FH5 contains 16 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	4-9	6	1
β-strand	13	1	2
β-strand	14-18	5	1
β-strand	19	1	3
β-strand	23	1	3
α-helix	28-35	8
α-helix	37-39	3
β-strand	53-59	7	1
β-strand	64-70	7	1
α-helix	73-75	3
α-helix	76-93	18
α-helix	95-99	5
α-helix	104-107	4
α-helix	114-127	14

Chain B: 9 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	64-68	5	4
α-helix	75-84	10
β-strand	90	1	2
β-strand	97-102	6	4
β-strand	110-115	6	4
α-helix	116-117	2
α-helix	120-130	11
α-helix	131-133	3
β-strand	134-142	9	4
α-helix	146-165	20
β-strand	172-178	7	4
α-helix	185-187	3
α-helix	188-205	18
α-helix	232-234	3
β-strand	239-243	5	4
β-strand	245	1	5
β-strand	257	1	5
α-helix	259-268	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Signal recognition particle receptor alpha subunit	A	protein	185	Homo sapiens	P08240 (AlphaFold model)
Signal recognition particle receptor beta subunit	B	protein	214	Mus musculus	P47758 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2FH5_1 Signal recognition particle receptor alpha subunit (chains A)
MSHHHHHHSMVDFFTIFSKGGLVLWCFQGVSDSCTGPVNALIRSVLLQERGGNNSFTHEA
LTLKYKLDNQFELVFVVGFQKILTLTYVDKLIDDVHRLFRDKYRTEIQQQSALSLLNGTF
DFQNDFLRLLREAEESSKIRAPTTMKKFEDSEKAKKPVRSMIETRGEKPKEKAKNSKKKG
AKKEG

Sequence of entity 2 (B), FASTA

>2FH5_2 Signal recognition particle receptor beta subunit (chains B)
MARKSSQRAVLFVGLCDSGKTLLFVRLLTGQYRDTQTSITDSSAIYKVNNNRGNSLTLID
LPGHESLRFQLLDRFKSSARAVVFVVDSAAFQREVKDVAEFLYQVLIDSMALKNSPSLLI
ACNKQDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLDSSSTAPAQLGKKGKEFEFSQL
PLKVEFLECSAKGGRGDTGSADIQDLEKWLAKIA

Ligands and cofactors

ID	Name	Formula	Copies
GTP	Guanosine-5'-triphosphate	C10 H16 N5 O14 P3	1
MG	Magnesium ion	Mg	1

Primary citation

The structure of the mammalian signal recognition particle (SRP) receptor as prototype for the interaction of small GTPases with Longin domains. Schlenker, O., Hendricks, A., Sinning, I. et al. J Biol Chem (2006) 281:8898-8906. DOI 10.1074/jbc.M512415200 · PubMed

Other PDB entries of the same protein (UniProt P08240 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6Y32 2.6 Å, Structure of the GTPase heterodimer of human SRP54 and SRalpha
5L3Q 3.2 Å, Structure of the GTPase heterodimer of human SRP54 and SRalpha
7NFX 3.2 Å, Mammalian ribosome nascent chain complex with SRP and SRP receptor in early state A
2GO5 7.4 Å, Structure of signal recognition particle receptor (SR) in complex with signal…

Browse structure collections

About this viewer

MolViewer shows 2FH5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.