2FOL: Human RAB1A

Crystal structure of human RAB1A in complex with GDP. Determined by X-ray diffraction at 2.63 Å resolution. Released 31 Jan 2006.

Method: X-ray diffraction
Resolution: 2.63 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,276
Mol. weight: 22.03 kDa
Ligands: MG, GDP
Released: 31 Jan 2006

Explore 2FOL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2FOL contains 5 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	7-15	9	1
α-helix	21-30	10
β-strand	46-52	7	1
β-strand	55-62	8	1
β-strand	83-89	7	1
β-strand	92	1	1
α-helix	93-97	5
α-helix	99-108	10
β-strand	115-121	7	1
α-helix	133-143	11
β-strand	147-149	3	1
β-strand	151	1	2
β-strand	156	1	2
α-helix	158-172	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ras-related protein Rab-1A	A	protein	191	Homo sapiens	P62820 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2FOL_1 Ras-related protein Rab-1A (chains A)
MGSSHHHHHHSSGLVPRGSPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGV
DFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWL
QEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFM
TMAAEIKKRMG

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1
GDP	Guanosine-5'-diphosphate	C10 H15 N5 O11 P2	1

Water and common crystallization additives (UNX) are not listed.

Primary citation

Crystal structure of human RAB1A in complex with GDP. Wang, J., Tempel, W., Shen, Y. et al. To be published.

Other PDB entries of the same protein (UniProt P62820 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2WWX 1.5 Å, Crystal structure of the SidM/DrrA(GEF/GDF domain)-Rab1(GTPase domain) complex
7EQ2 1.55 Å, Crystal structure of GDP-bound Rab1a-T75D
3SFV 1.73 Å, Crystal structure of the GDP-bound Rab1a S25N mutant in complex with the coiled-coil…
3TKL 2.18 Å, Crystal structure of the GTP-bound Rab1a in complex with the coiled-coil domain of LidA…
9MHF 2.73 Å, Cryo-EM reconstruction of PI3KC3-C1 in complex with Human RAB1A(Q70L)
4JVS 2.78 Å, Crystal structure of LepB GAP domain from Legionella drancourtii in complex with…
4FMC 2.8 Å, EspG-Rab1 complex
3L0I 2.85 Å, Complex structure of SidM/DrrA with the wild type Rab1
4FMD 3.05 Å, EspG-Rab1 complex structure at 3.05 A
4FMB 3.2 Å, VirA-Rab1 complex structure
4IRU 3.2 Å, Crystal Structure of lepB GAP core in a transition state mimetic complex with Rab1A and…
9MHG 3.2 Å, Cryo EM reconstruction of PI3KC3-C1 in complex with Human RAB1A(Q70L), VPS34 kinase…

Browse structure collections

About this viewer

MolViewer shows 2FOL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.