2FQ3: Transcription regulatory protein SWI3

Name: PDB 2FQ3: Structure and function of the SWIRM domain, a conserved protein module found in chromatin regulatory complexes
Published: 2006-02-07
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Structure and function of the SWIRM domain, a conserved protein module found in chromatin regulatory complexes. Determined by X-ray diffraction at 1.4 Å resolution. Released 7 Feb 2006.

Method: X-ray diffraction
Resolution: 1.4 Å
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 844
Mol. weight: 12.38 kDa
Released: 7 Feb 2006

Explore 2FQ3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2FQ3 contains 5 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	321-326	6
α-helix	328-330	3
α-helix	340-356	17
α-helix	364-370	7
α-helix	375-387	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription regulatory protein SWI3	A	protein	104	Saccharomyces cerevisiae	P32591 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2FQ3_1 Transcription regulatory protein SWI3 (chains A)
MRGSHHHHHHGMASSYSKWFNLEKIHSIEVQSLPEFFTNRIPSKTPEVYMRYRNFMVNSY
RLNPNEYFSVTTARRNVSGDAAALFRLHKFLTKWGLINYQVDSK

Primary citation

Structure and function of the SWIRM domain, a conserved protein module found in chromatin regulatory complexes. Da, G., Lenkart, J., Zhao, K. et al. Proc Natl Acad Sci U S A (2006) 103:2057-2062. DOI 10.1073/pnas.0510949103 · PubMed

Other PDB entries of the same protein (UniProt P32591 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6L9J 2.64 Å, Structure of yeast Snf5 and Swi3 subcomplex
7C4J 2.89 Å, Cryo-EM structure of the yeast Swi/Snf complex in a nucleosome free state
7EGM 3.6 Å, The SRM module of SWI/SNF-nucleosome complex
6UXV 4.7 Å, SWI/SNF Body Module
7EGP 6.9 Å, The structure of SWI/SNF-nucleosome complex
6UXW 8.96 Å, SWI/SNF nucleosome complex with ADP-BeFx

Browse structure collections

About this viewer

MolViewer shows 2FQ3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.