6L9J: Yeast Snf5 and Swi3 subcomplex
Structure of yeast Snf5 and Swi3 subcomplex. Determined by X-ray diffraction at 2.64 Å resolution. Released 11 Nov 2020.
- Method
- X-ray diffraction
- Resolution
- 2.64 Å
- Organism
- Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
- Chains
- 12
- Atoms
- 13,673
- Mol. weight
- 280.93 kDa
- Released
- 11 Nov 2020
Explore 6L9J in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
6L9J contains 96 α-helices and 28 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 10 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 457-464 | 8 | 1 |
| β-strand | 473-480 | 8 | 1 |
| α-helix | 488-495 | 8 | |
| α-helix | 506-523 | 18 | |
| β-strand | 543-552 | 10 | 2 |
| β-strand | 555-564 | 10 | 2 |
| α-helix | 572-582 | 11 | |
| α-helix | 588-610 | 23 | |
| α-helix | 618-620 | 3 | |
| α-helix | 623-628 | 6 | |
| α-helix | 630-632 | 3 | |
| β-strand | 639 | 1 | 3 |
| α-helix | 640-641 | 2 | |
| α-helix | 642-647 | 6 | |
| β-strand | 651-654 | 4 | 2 |
| α-helix | 657-664 | 8 | |
Chain B: 6 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 309-311 | 3 | |
| α-helix | 321-326 | 6 | |
| α-helix | 328-330 | 3 | |
| α-helix | 340-356 | 17 | |
| α-helix | 364-370 | 7 | |
| α-helix | 375-387 | 13 | |
Chain C: 5 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 309-311 | 3 | |
| α-helix | 321-326 | 6 | |
| α-helix | 340-356 | 17 | |
| α-helix | 364-370 | 7 | |
| β-strand | 371 | 1 | 3 |
| α-helix | 375-387 | 13 | |
Chain D: 11 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 457-464 | 8 | 4 |
| β-strand | 473-480 | 8 | 4 |
| α-helix | 488-498 | 11 | |
| α-helix | 503-522 | 20 | |
| α-helix | 528-531 | 4 | |
| β-strand | 543-552 | 10 | 5 |
| β-strand | 555-564 | 10 | 5 |
| α-helix | 572-582 | 11 | |
| α-helix | 589-609 | 21 | |
| α-helix | 623-627 | 5 | |
| α-helix | 630-632 | 3 | |
| α-helix | 635-637 | 3 | |
| β-strand | 639 | 1 | 6 |
| α-helix | 640-641 | 2 | |
| α-helix | 642-645 | 4 | |
| β-strand | 651-654 | 4 | 5 |
| α-helix | 657-664 | 8 | |
Chain E: 8 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 302-305 | 4 | |
| α-helix | 309-311 | 3 | |
| α-helix | 321-326 | 6 | |
| α-helix | 328-330 | 3 | |
| α-helix | 342-354 | 13 | |
| α-helix | 361-362 | 2 | |
| α-helix | 364-370 | 7 | |
| α-helix | 375-387 | 13 | |
Chain F: 6 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 309-311 | 3 | |
| α-helix | 321-326 | 6 | |
| α-helix | 328-330 | 3 | |
| α-helix | 340-356 | 17 | |
| α-helix | 364-370 | 7 | |
| β-strand | 371 | 1 | 6 |
| α-helix | 375-387 | 13 | |
Chain G: 10 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 457-464 | 8 | 7 |
| α-helix | 466-469 | 4 | |
| β-strand | 473-480 | 8 | 7 |
| α-helix | 488-495 | 8 | |
| α-helix | 507-521 | 15 | |
| α-helix | 528-531 | 4 | |
| β-strand | 543-552 | 10 | 8 |
| β-strand | 555-564 | 10 | 8 |
| α-helix | 572-582 | 11 | |
| α-helix | 588-610 | 23 | |
| α-helix | 623-627 | 5 | |
| β-strand | 639 | 1 | 9 |
| α-helix | 640-641 | 2 | |
| α-helix | 642-645 | 4 | |
| β-strand | 651-654 | 4 | 8 |
| α-helix | 657-665 | 9 | |
Chain H: 8 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 303-305 | 3 | |
| α-helix | 309-311 | 3 | |
| α-helix | 321-326 | 6 | |
| α-helix | 328-330 | 3 | |
| α-helix | 336-338 | 3 | |
| α-helix | 340-356 | 17 | |
| α-helix | 364-370 | 7 | |
| α-helix | 375-387 | 13 | |
4 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| SWI/SNF chromatin-remodeling complex subunit SNF5 | A, D, G, J | protein | 227 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | P18480 (AlphaFold model) |
| SWI/SNF complex subunit SWI3 | B, C, E, F, H, I, K, L | protein | 187 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | P32591 (AlphaFold model) |
Sequence of entity 1 (A, D, G, J), FASTA
>6L9J_1 SWI/SNF chromatin-remodeling complex subunit SNF5 (chains A, D, G, J)
SEQLVPIRLEFDQDRDRFFLRDTLLWNKNDKLIKIEDFVDDMLRDYRFEDATREQHIDTI
CQSIQEQIQEFQGNPYIELNQDRLGGDDLRIRIKLDIVVGQNQLIDQFEWDISNSDNCPE
EFAESMCQELELPGEFVTAIAHSIREQVHMYHKSLALLGYNFDGSAIEDDDIRSRMLPTI
TLDDVYRPAAESKIFTPNLLQISAAELERLDKDKDRDTRRKRRQGRS
Sequence of entity 2 (B, C, E, F, H, I, K, L), FASTA
>6L9J_2 SWI/SNF complex subunit SWI3 (chains B, C, E, F, H, I, K, L)
DNSIFGDTKSESKQLGNTSSVANTPSEIPDAHKAEQEDIIEKTESVDKKVDSGEERNEQE
REIMNDHSKSANPKKTTITRVEPETFEIPQAHEIVIPSYSKWFNLEKIHSIEVQSLPEFF
TNRIPSKTPEVYMRYRNFMVNSYRLNPNEYFSVTTARRNVSGDAAALFRLHKFLTKWGLI
NYQVDSK
Primary citation
Snf5 and Swi3 subcomplex formation is required for SWI/SNF complex function in yeast. Zhou, H., Chen, G., Dong, C. et al. Biochem Biophys Res Commun (2020) 526:934-940. DOI 10.1016/j.bbrc.2020.03.169 · PubMed
Other PDB entries of the same protein (UniProt P18480 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 7C4J 2.89 Å, Cryo-EM structure of the yeast Swi/Snf complex in a nucleosome free state
- 7EG6 3.1 Å, Snf5 Finger Helix bound to the nucleosome
- 7EGM 3.6 Å, The SRM module of SWI/SNF-nucleosome complex
- 9PB7 4.4 Å, TFIIH of PIC-Med-SWI/SNF
- 6UXV 4.7 Å, SWI/SNF Body Module
- 7EGP 6.9 Å, The structure of SWI/SNF-nucleosome complex
- 6UXW 8.96 Å, SWI/SNF nucleosome complex with ADP-BeFx
Browse structure collections
About this viewer
MolViewer shows 6L9J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.