2FTX: Yeast kinetochore Spc24/Spc25 globular domain

Crystal structure of the yeast kinetochore Spc24/Spc25 globular domain. Determined by X-ray diffraction at 1.9 Å resolution. Released 13 Jun 2006.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 1,267
Mol. weight: 17.68 kDa
Ligands: PO4
Released: 13 Jun 2006

Explore 2FTX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2FTX contains 6 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	134-145	12
β-strand	147-151	5	1
β-strand	159-163	5	1
β-strand	169-173	5	1
β-strand	181-185	5	1
α-helix	190-201	12
α-helix	206-219	14

Chain B: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	157-167	11
β-strand	170-173	4	2
α-helix	174-176	3
β-strand	178-181	4	2
β-strand	190-193	4	2
α-helix	200-211	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Hypothetical 25.2 kDa protein in AFG3-SEB2 intergenic region	A	protein	90	Saccharomyces cerevisiae	P40014 (AlphaFold model)
Hypothetical 24.6 kDa protein in ILV2-ADE17 intergenic region	B	protein	64	Saccharomyces cerevisiae	Q04477 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2FTX_1 Hypothetical 25.2 kDa protein in AFG3-SEB2 intergenic region (chains A)
MNDAAEVALYERLLQLRVLPGASDVHDVRFVFGDDSRCWIEVAMHGDHVIGNSHPALDPK
SRATLEHVLTVQGDLAAFLVVARDMLLASL

Sequence of entity 2 (B), FASTA

>2FTX_2 Hypothetical 24.6 kDa protein in ILV2-ADE17 intergenic region (chains B)
GSHMEANENILKLKLYRSLGVILDLENDQVLINRKNDGNIDILPLDNNLSDFYKTKYIWE
RLGK

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	1

Water and common crystallization additives (NA) are not listed.

Primary citation

Atomic Structure of the kinetochore Spc24p/Spc25p globular domain reveals a novel fold. Wei, R.R., Harrison, S.C., Schnell, J.R. et al. To be published.

Other PDB entries of the same protein (UniProt P40014 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5T6J 1.75 Å, Structure of the MIND Complex Shows a Regulatory Focus of Yeast Kinetochore Assembly
4GEQ 2.01 Å, Crystal structure of the Spc24-Spc25/Cnn1 binding interface
7KDF 2.72 Å, Structure of Stu2 Bound to dwarf Ndc80c
5TCS 2.83 Å, Crystal structure of a Dwarf Ndc80 Tetramer
8V10 3.02 Å, Structure of a Saccharomyces cerevisiae Mps1 peptide bound to dwarf Ndc80 Complex
8V11 3.95 Å, Structure of a Saccharomyces cerevisiae Ipl1 peptide Bound to dwarf Ndc80 complex
9S4Q 4.9 Å, Cryo-EM structure of the Saccharomyces cerevisiae KMN junction complex lacking the…
9S5N 7.2 Å, Cryo-EM structure of the Saccharomyces cerevisiae KMN junction complex containing the…
5TD8 7.53 Å, Crystal structure of an Extended Dwarf Ndc80 Complex
2FV4 NMR solution structure of the yeast kinetochore Spc24/Spc25 globular domain

Browse structure collections

About this viewer

MolViewer shows 2FTX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.