2FXT: Yeast Tim44

Crystal Structure of Yeast Tim44. Determined by X-ray diffraction at 3.2 Å resolution. Released 6 Feb 2007.

Method: X-ray diffraction
Resolution: 3.2 Å
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 1,551
Mol. weight: 22.02 kDa
Released: 6 Feb 2007

Explore 2FXT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2FXT contains 8 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	235-243	9
α-helix	249-258	10
β-strand	265	1	1
α-helix	271-280	10
α-helix	286-291	6
α-helix	292-297	6
α-helix	298-306	9
α-helix	310-316	7
β-strand	317	1	1
α-helix	319-334	16
β-strand	337-338	2	2
β-strand	341-343	3	3
β-strand	347-357	11	1
β-strand	362-371	10	1
β-strand	373-375	3	3
β-strand	378-379	2	2
β-strand	383	1	2
β-strand	396-403	8	1
β-strand	418-423	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Import inner membrane translocase subunit TIM44	A	protein	192	Saccharomyces cerevisiae	Q01852 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2FXT_1 Import inner membrane translocase subunit TIM44 (chains A)
SIQSLKNKLWDESENPLIVVMRKITNKVGGFFAETESSRVYSQFKLMDPTFSNESFTRHL
REYIVPEILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDVYADGRILDIRGVEIVS
AKLLAPQDIPVLVVGCRAQEINLYRKKKTGEIAAGDEANILMSSYAMVFTRDPEQIDDDE
TEGWKILEFVRG

Primary citation

Crystal Structure of Yeast Mitochondrial Peripheral Membrane Protein Tim44p C-terminal Domain. Josyula, R., Jin, Z., Fu, Z. et al. J Mol Biol (2006) 359:798-804. DOI 10.1016/j.jmb.2006.04.020 · PubMed

Other PDB entries of the same protein (UniProt Q01852 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8E1M 2.9 Å, Cryo-EM structure of the endogenous core TIM23 complex from S. cerevisiae
3QK9 3.1 Å, Yeast Tim44 C-terminal domain complexed with Cymal-3
9N84 3.2 Å, Yeast TIM23 complex inhibited by stendomycin
9J9B 3.83 Å, Substrate-engaged TIM23 complex from yeast

Browse structure collections

About this viewer

MolViewer shows 2FXT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.