3QK9: Yeast Tim44 C-terminal domain

Yeast Tim44 C-terminal domain complexed with Cymal-3. Determined by X-ray diffraction at 3.1 Å resolution. Released 9 Mar 2011.

Method: X-ray diffraction
Resolution: 3.1 Å
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 2,845
Mol. weight: 50.95 kDa
Released: 9 Mar 2011

Explore 3QK9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3QK9 contains 17 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	237-245	9
α-helix	249-257	9
α-helix	271-274	4
α-helix	286-292	7
α-helix	293-297	5
α-helix	298-307	10
α-helix	310-316	7
β-strand	317	1	1
α-helix	319-333	15
β-strand	337-339	3	2
β-strand	342-356	15	1
β-strand	363-374	12	1
β-strand	377-379	3	2
α-helix	393	1
β-strand	394-404	11	1
β-strand	417-423	7	1

Chain B: 8 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	236-243	8
α-helix	249-258	10
α-helix	271-274	4
α-helix	286-292	7
α-helix	293-297	5
α-helix	298-307	10
α-helix	310-316	7
β-strand	317	1	3
α-helix	319-334	16
β-strand	337-356	20	3
β-strand	363-379	17	3
β-strand	385-388	4	3
β-strand	394-404	11	3
β-strand	417-426	10	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mitochondrial import inner membrane translocase subunit TIM44	A, B	protein	222	Saccharomyces cerevisiae	Q01852 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3QK9_1 Mitochondrial import inner membrane translocase subunit TIM44 (chains A, B)
TNIESKESFGKKVEDFKEKTVVGRSIQSLKNKLWDESENPLIVVMRKITNKVGGFFAETE
SSRVYSQFKLMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYAAQQ
KIFKEQDVYADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGEIAAGD
EANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT

Primary citation

Membrane Binding Mechanism of Yeast Mitochondrial Peripheral Membrane Protein TIM44. Cui, W., Josyula, R., Li, J. et al. Protein Pept Lett (2011) 18:718-725. PubMed

Other PDB entries of the same protein (UniProt Q01852 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8E1M 2.9 Å, Cryo-EM structure of the endogenous core TIM23 complex from S. cerevisiae
2FXT 3.2 Å, Crystal Structure of Yeast Tim44
9N84 3.2 Å, Yeast TIM23 complex inhibited by stendomycin
9J9B 3.83 Å, Substrate-engaged TIM23 complex from yeast

Browse structure collections

About this viewer

MolViewer shows 3QK9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.