2FYG: NSP10 from Sars coronavirus

Crystal structure of NSP10 from Sars coronavirus. Determined by X-ray diffraction at 1.8 Å resolution. Released 8 Aug 2006.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: SARS coronavirus
Chains: 1
Atoms: 1,155
Mol. weight: 14.09 kDa
Ligands: ZN
Released: 8 Aug 2006

Explore 2FYG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2FYG contains 8 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	10-18	9
α-helix	23-32	10
α-helix	35-38	4
β-strand	43	1	1
α-helix	44-45	2
β-strand	55-56	2	1
β-strand	65-69	5	1
α-helix	71-73	3
α-helix	75-79	5
β-strand	96-100	5	1
α-helix	101-103	3
α-helix	107-113	7
β-strand	116	1	2
β-strand	123	1	2
β-strand	126-127	2	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Replicase polyprotein 1ab	A	protein	128	SARS coronavirus	P0C6U8

Sequence of entity 1 (A), FASTA

>2FYG_1 Replicase polyprotein 1ab (chains A)
HHHHHNSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMD
QESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWK
GYGCSCDQ

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Water and common crystallization additives (GOL) are not listed.

Primary citation

Crystal structure of nonstructural protein 10 from the severe acute respiratory syndrome coronavirus reveals a novel fold with two zinc-binding motifs. Joseph, J.S., Saikatendu, K.S., Subramanian, V. et al. J Virol (2006) 80:7894-7901. DOI 10.1128/JVI.00467-06 · PubMed

Other PDB entries of the same protein (UniProt P0C6U8), best resolution first:

6XHN 1.38 Å, Covalent complex of SARS-CoV main protease with 4-methoxy-N-[(2S)-4-methyl-1-oxo-1-({(2S)…
4M0W 1.4 Å, Crystal Structure of SARS-CoV papain-like protease C112S mutant in complex with ubiquitin
6XHO 1.45 Å, Covalent complex of SARS-CoV main protease with ethyl (4R)-4-({N-[(4-methoxy-1H-indol-2-y…
6XHL 1.47 Å, Covalent complex of SARS-CoV main protease with N-[(2S)-1-({(2S,3S)-3,4-dihydroxy-1-[(3S)…
4MDS 1.6 Å, Discovery of N-(benzo[1,2,3]triazol-1-yl)-N-(benzyl)acetamido)phenyl) carboxamides as…
2H2Z 1.6 Å, Crystal structure of SARS-CoV main protease with authentic N and C-termini
7LMG 1.6 Å, SARS-CoV-1 3CLPro in complex with N-(4-(1H-imidazol-4-yl)phenyl)-2-(1H-benzo[d][1,2,3]tri…
7RC1 1.63 Å, X-ray Structure of SARS-CoV main protease covalently modified by compound GRL-0686
5Y3E 1.65 Å, Crystal structure of SARS coronavirus papain-like protease in complex with glycerol
5Y3Q 1.65 Å, Crystal structure of SARS coronavirus papain-like protease conjugated with…
6W2A 1.65 Å, 1.65 A resolution structure of SARS-CoV 3CL protease in complex with inhibitor 7j
7LMJ 1.69 Å, SARS-CoV-1 3CLPro in complex with 2-(1H-benzo[d][1,2,3]triazol-1-yl)-N-(3-chlorobenzyl)-N…

Browse structure collections

About this viewer

MolViewer shows 2FYG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.