NMR Solution structure of calcium-loaded LRP double module. Determined by solution NMR. Released 10 Oct 2006.
Explore 2FYJ in 3D Show helices and sheets RCSB PDB PDBe
2FYJ contains 0 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 9-11 | 3 | 1 |
| β-strand | 17-19 | 3 | 1 |
| β-strand | 50-52 | 3 | 2 |
| β-strand | 58-60 | 3 | 2 |
| β-strand | 64 | 1 | 3 |
| β-strand | 69 | 1 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Low-density lipoprotein receptor-related protein 1 | A | protein | 82 | Homo sapiens | Q07954 (AlphaFold model) |
>2FYJ_1 Low-density lipoprotein receptor-related protein 1 (chains A) SARTCPPNQFSCASGRCIPISWTCDLDDDCGDRSDESASCAYPTCFPLTQFTCNNGRCIN INWRCDNDNDCGDNSDEAGCSH
Binding Site Structure of One LRP-RAP Complex:Implications for a Common Ligand-Receptor Binding Motif. Jensen, G.A., Andersen, O.M., Bonvin, A.M. et al. J Mol Biol (2006) 362:700-716. DOI 10.1016/j.jmb.2006.07.013 · PubMed
Other PDB entries of the same protein (UniProt Q07954 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2FYJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.