2FYL: PDB entry 2FYL

Haddock model of the complex between double module of LRP, CR56, and first domain of receptor associated protein, RAP-d1. Determined by solution NMR. Released 10 Oct 2006.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,288
Mol. weight: 18.56 kDa
Ligands: CA
Released: 10 Oct 2006

Explore 2FYL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2FYL contains 4 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	23-34	12
α-helix	39-65	27
α-helix	72-88	17

Chain B: 1 helix, 4 β-strands

Element	Residues	Length	Sheet
β-strand	9-10	2	1
β-strand	18-19	2	1
α-helix	20-22	3
β-strand	50-53	4	2
β-strand	57-60	4	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha-2-macroglobulin receptor-associated protein	A	protein	81	Homo sapiens	P30533 (AlphaFold model)
Low-density lipoprotein receptor-related protein 1	B	protein	82	Homo sapiens	Q07954 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2FYL_1 Alpha-2-macroglobulin receptor-associated protein (chains A)
GEEFRMEKLNQLWEKAQRLHLPPVRLAELHADLKIQERDELAWKKLKLDGLDEDGEKEAR
LIRNLNVILAKYGLDGKKDAR

Sequence of entity 2 (B), FASTA

>2FYL_2 Low-density lipoprotein receptor-related protein 1 (chains B)
SARTCPPNQFSCASGRCIPISWTCDLDDDCGDRSDESASCAYPTCFPLTQFTCNNGRCIN
INWRCDNDNDCGDNSDEAGCSH

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	2

Primary citation

Binding Site Structure of One LRP-RAP Complex:Implications for a Common Ligand-Receptor Binding Motif. Jensen, G.A., Andersen, O.M., Bonvin, A.M. et al. J Mol Biol (2006) 362:700-716. DOI 10.1016/j.jmb.2006.07.013 · PubMed

Other PDB entries of the same protein (UniProt P30533 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2FCW 1.26 Å, Structure of a Complex Between the Pair of the LDL Receptor Ligand-Binding Modules 3-4…
9QAW 3.34 Å, CryoEM structure of the human LRP2 receptor ectodomain in complex with LRPAP1
1LRE Receptor associated protein (RAP) domain 1, NMR, 20 structures
1NRE Receptor associated protein (RAP) domain 1, NMR, minimized average structure
1OP1 Solution NMR structure of domain 1 of receptor associated protein
1OV2 Ensemble of the solution structures of domain one of receptor associated protein
2FTU solution structure of domain 3 of RAP
2P01 The structure of receptor-associated protein(RAP)
2P03 The structure of receptor-associated protein(RAP)

Browse structure collections

About this viewer

MolViewer shows 2FYL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.