2G62: Human PTPA

Crystal structure of human PTPA. Determined by X-ray diffraction at 1.6 Å resolution. Released 4 Apr 2006.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,944
Mol. weight: 37.8 kDa
Released: 4 Apr 2006

Explore 2G62 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2G62 contains 23 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 23 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	27-28	2	1
α-helix	33-35	3
α-helix	36-40	5
β-strand	42	1	2
α-helix	43-58	16
α-helix	72-89	18
α-helix	104-121	18
α-helix	126-131	6
α-helix	132-140	9
β-strand	145	1	3
β-strand	150-151	2	3
α-helix	153-168	16
α-helix	174-176	3
α-helix	177-179	3
α-helix	180-185	6
α-helix	186-198	13
α-helix	201	1
β-strand	202-203	2	3
α-helix	218-226	9
α-helix	235-239	5
α-helix	241-247	7
α-helix	252-263	12
α-helix	268-271	4
α-helix	273-278	6
α-helix	284-295	12
α-helix	296-300	5
α-helix	303-306	4
β-strand	310-311	2	1
β-strand	319	1	2
α-helix	320-321	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
protein phosphatase 2A, regulatory subunit B' (PR 53)	A	protein	325	Homo sapiens	Q15257 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2G62_1 protein phosphatase 2A, regulatory subunit B' (PR 53) (chains A)
MHHHHHHSSGVDLGTENLYFQSRNFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEG
VKGKKLTFEYRVSEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAEN
LVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQI
AIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHF
VDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAE
CLEKFPVIQHFKFGSLLPIHPVTSG

Primary citation

The crystal structure of a human PP2A phosphatase activator reveals a novel fold and highly conserved cleft implicated in protein-protein interactions. Magnusdottir, A., Stenmark, P., Flodin, S. et al. J Biol Chem (2006) 281:22434-22438. DOI 10.1074/jbc.C600100200 · PubMed

Other PDB entries of the same protein (UniProt Q15257 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2IXM 1.5 Å, Structure of human PTPA
4NY3 1.8 Å, Human PTPA in complex with peptide
2HV6 1.9 Å, Crystal structure of the phosphotyrosyl phosphatase activator
2HV7 2.5 Å, Crystal structure of phosphotyrosyl phosphatase activator bound to ATPgammaS
4LAC 2.82 Å, Crystal Structure of Protein Phosphatase 2A (PP2A) and PP2A phosphatase activator (PTPA)…

Browse structure collections

About this viewer

MolViewer shows 2G62 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.