2HV6: Phosphotyrosyl phosphatase activator

Crystal structure of the phosphotyrosyl phosphatase activator. Determined by X-ray diffraction at 1.9 Å resolution. Released 22 Aug 2006.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,038
Mol. weight: 73.66 kDa
Ligands: MG
Released: 22 Aug 2006

Explore 2HV6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2HV6 contains 47 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 24 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	27-28	2	1
α-helix	35-41	7
β-strand	42	1	2
α-helix	43-59	17
α-helix	72-90	19
α-helix	92-95	4
α-helix	104-120	17
α-helix	126-131	6
α-helix	132-140	9
β-strand	145	1	3
β-strand	150-151	2	3
α-helix	153-168	16
α-helix	174-176	3
α-helix	177-179	3
α-helix	180-185	6
α-helix	186-198	13
α-helix	201	1
β-strand	202-203	2	3
α-helix	207-210	4
α-helix	218-227	10
α-helix	235-239	5
α-helix	241-247	7
α-helix	252-263	12
α-helix	268-271	4
α-helix	273-278	6
α-helix	284-295	12
α-helix	296-300	5
α-helix	303-306	4
β-strand	310-311	2	1
β-strand	319	1	2
α-helix	320	1

Chain B: 23 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	27-28	2	4
α-helix	34-38	5
β-strand	42	1	5
α-helix	43-59	17
α-helix	69-71	3
α-helix	74-90	17
α-helix	92-94	3
α-helix	104-120	17
α-helix	126-131	6
α-helix	132-140	9
β-strand	145	1	6
β-strand	150-151	2	6
α-helix	153-168	16
α-helix	177-179	3
α-helix	180-185	6
α-helix	186-199	14
α-helix	201	1
β-strand	202-203	2	6
α-helix	212-215	4
α-helix	218-227	10
α-helix	235-239	5
α-helix	241-247	7
α-helix	252-262	11
α-helix	274-279	6
α-helix	284-296	13
α-helix	299-301	3
α-helix	303-306	4
β-strand	310-311	2	4
β-strand	319	1	5
α-helix	320	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein phosphatase 2A, regulatory subunit B	A, B	protein	323	Homo sapiens	Q15257 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2HV6_1 Protein phosphatase 2A, regulatory subunit B (chains A, B)
MAEGERQPPPDSSEEAPPATQNFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVK
GKKLTFEYRVSEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLV
ATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAI
VFKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVD
EKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECL
EKFPVIQHFKFGSLLPIHPVTSG

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1

Primary citation

Structure and mechanism of the phosphotyrosyl phosphatase activator. Chao, Y., Xing, Y., Chen, Y. et al. Mol Cell (2006) 23:535-546. DOI 10.1016/j.molcel.2006.07.027 · PubMed

Other PDB entries of the same protein (UniProt Q15257 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2IXM 1.5 Å, Structure of human PTPA
2G62 1.6 Å, Crystal structure of human PTPA
4NY3 1.8 Å, Human PTPA in complex with peptide
2HV7 2.5 Å, Crystal structure of phosphotyrosyl phosphatase activator bound to ATPgammaS
4LAC 2.82 Å, Crystal Structure of Protein Phosphatase 2A (PP2A) and PP2A phosphatase activator (PTPA)…

Browse structure collections

About this viewer

MolViewer shows 2HV6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.