2GGF: MA3 domain of human Programmed cell death 4

Solution structure of the MA3 domain of human Programmed cell death 4. Determined by solution NMR. Released 24 Apr 2007.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,081
Mol. weight: 15.45 kDa
Released: 24 Apr 2007

Explore 2GGF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2GGF contains 8 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	328-341	14
α-helix	344-353	10
α-helix	357-359	3
α-helix	360-373	14
α-helix	377-392	16
α-helix	398-418	21
α-helix	422-436	15
α-helix	441-446	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Programmed cell death 4, isoform 1	A	protein	137	Homo sapiens	Q53EL6 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2GGF_1 Programmed cell death 4, isoform 1 (chains A)
GSSGSSGLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFHHELVYEAIIMVLESTGEST
FKMILDLLKSLWKSSTITVDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGII
SKQLRDLCPSRSGPSSG

Primary citation

Solution structure of the MA3 domain of human Programmed cell death 4. Nagata, T., Muto, Y., Inoue, M. et al. To be published.

Other PDB entries of the same protein (UniProt Q53EL6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9TES 1.22 Å, Crystal structure of beta-TrCP bound by diphosphorylated PDCD4 degron peptide
2RG8 1.8 Å, Crystal Structure of Programmed for Cell Death 4 Middle MA3 domain
9BKD 2.6 Å, The structure of human Pdcd4 bound to the 40S small ribosomal subunit
2ZU6 2.8 Å, crystal structure of the eIF4A-PDCD4 complex
3EIJ 2.8 Å, Crystal structure of Pdcd4
8XXL 2.9 Å, Cryo-EM structure of the human 40S ribosome with PDCD4
8XXM 3.2 Å, Cryo-EM structure of the human 40S ribosome with PDCD4 and eIF3G
8XXN 3.6 Å, Cryo-EM structure of the human 43S ribosome with PDCD4
9BLN 3.9 Å, The structure of human Pdcd4 bound to the 40S-eIF4A-eIF3-eIF1 complex
2KZT Structure of the Tandem MA-3 Region of Pdcd4

Browse structure collections

About this viewer

MolViewer shows 2GGF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.